PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400038361
Common NameLOC102584379
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 186aa    MW: 20432.7 Da    PI: 5.9489
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400038361genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.91.1e-5622117297
                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                           reqdrflPianvsrimkk+lPanakiskdake+vqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+y+eplk+yl+++
  PGSC0003DMP400038361  22 REQDRFLPIANVSRIMKKALPANAKISKDAKEVVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYIEPLKIYLQRF 110
                           89*************************************************************************************** PP

                 NF-YB  91 relegek 97 
                           r+leg+k
  PGSC0003DMP400038361 111 RDLEGQK 117
                           ****986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.6E-5418127IPR009072Histone-fold
SuperFamilySSF471139.94E-4124129IPR009072Histone-fold
PfamPF008086.7E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.2E-205573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.2E-207492No hitNo description
PRINTSPR006151.2E-2093111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MADSDNESGG HRENSNIESS LREQDRFLPI ANVSRIMKKA LPANAKISKD AKEVVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYI EPLKIYLQRF RDLEGQKSGI  120
SGEKDNGGSV NIGGYVEDYH GMMMMGNQHH QGHGYGTGVY NHQTGENAAG VGTGGSRFPD  180
VGRQR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B2e-4720112294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-4720112294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400038361
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0132280.0BT013228.1 Lycopersicon esculentum clone 134470F, mRNA sequence.
GenBankHG9755190.0HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006346138.11e-137PREDICTED: nuclear transcription factor Y subunit B-3-like
RefseqXP_015163652.11e-137PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233104e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLM1C0B31e-136M1C0B3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000570661e-136(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.12e-73nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Han X, et al.
    Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis.
    J. Exp. Bot., 2013. 64(14): p. 4589-601
    [PMID:24006421]
  3. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  4. Hossain MA, et al.
    Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
    Front Plant Sci, 2016. 7: p. 650
    [PMID:27242851]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]