PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400038282
Common NameLOC102590856
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 745aa    MW: 80526.4 Da    PI: 6.4407
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400038282genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.36.5e-33319376260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  +++++ei+Y+g Hnh+k
  PGSC0003DMP400038282 319 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSP-EGHITEIIYKGAHNHPK 376
                           8****************************************.***************85 PP

2WRKY104.17.5e-33534592159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYY+CtsagC+v+k+ver+++d k v++tYeg+Hnh+
  PGSC0003DMP400038282 534 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCNVRKHVERASHDLKSVITTYEGKHNHD 592
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.135313377IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.8E-29316377IPR003657WRKY domain
SuperFamilySSF1182907.06E-26317377IPR003657WRKY domain
SMARTSM007741.4E-36318376IPR003657WRKY domain
PfamPF031062.7E-25319375IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.5E-37519594IPR003657WRKY domain
SuperFamilySSF1182901.57E-28526594IPR003657WRKY domain
PROSITE profilePS5081138.733529594IPR003657WRKY domain
SMARTSM007746.6E-38534593IPR003657WRKY domain
PfamPF031065.1E-25535592IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MGGFDDHVAI MGDWMPPSPS PRTFFSSLLG DDVGSRSSFE GTNETSGNLA SGPQEHVGNS  60
DRNDGAQAAI SEPQPVKFSA LSDQKMSSRG GGLLERIAAR AGFNAPKLNT ESLRPADLMQ  120
NQGVRSPYLT IPPGLSPTTL LESPVFLSNS LVQPSPTTGK FLFSSGIENR NSALMMEDTD  180
KRKDNALESI NSSSFSFKPV PETAPSLFPG TTSRVNPSNF SQQGFPNIEV SVHSQNSLVS  240
HRVEATQNPT QSGTLQQSSD FPRFSAEKDV MGNNVTLESR TFQTVGSAVD HSPPLDEPQD  300
EDIDQRGGGD PNVAGAPAED GYNWRKYGQK QVKGSEYPRS YYKCTHPNCP VKKKVERSPE  360
GHITEIIYKG AHNHPKPPPN RRSALGSTNS LGDLQLDGAE QGASGVNGDL GQANFQKAPG  420
AGGGFDWRNN NLDATSSANL GSEYCNRSAP FSAQNNTRLE SGDAVDVSST FSNDEDEDDR  480
GTHGSVSQGY DGEGDESESK RRKLETYSAD MTGATRAIRE PRVVVQTTSE VDILDDGYRW  540
RKYGQKVVKG NPNPRSYYKC TSAGCNVRKH VERASHDLKS VITTYEGKHN HDVPAARNSS  600
HVNSGASNTH PTSVTGPAQN HLHRPEAAQL QNAMAQFDRQ PSLGSFGLSR RPQLGPNPGF  660
SYGMNQQGGL SSLAMAGFHP NQNKPGEFHM HPYLGQPRPM HDMGFMFPKE EPKVEPMSDP  720
GLNLANGSAV YQQFMNRLPL GPQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-37319595878Probable WRKY transcription factor 4
2lex_A8e-37319595878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400038282
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB7111240.0AB711124.1 Solanum tuberosum StWRKY11 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006346070.10.0PREDICTED: probable WRKY transcription factor 2 isoform X2
RefseqXP_006346071.10.0PREDICTED: probable WRKY transcription factor 2 isoform X2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLM1C0460.0M1C046_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000569520.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  5. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]