PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400037408
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 149aa    MW: 17368.7 Da    PI: 9.2132
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400037408genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1744.4e-5471361129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPtdeelv++yL+kk+++++++l +vik++d+yk+ePwdL++  ++ +ee+ +wyfFs++dkky+tg+r+nrat++g+Wkat
  PGSC0003DMP400037408   7 VPPGFRFHPTDEELVDYYLRKKITSRRIDL-DVIKDIDLYKIEPWDLQElcRMGTEEQsDWYFFSHKDKKYPTGTRTNRATAAGFWKAT 94 
                           69****************************.9***************954555554445****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           g+dk+++s k+ l+g++ktLv+ykgrap+g+k+d +mheyrle
  PGSC0003DMP400037408  95 GRDKAIYS-KHDLIGMRKTLVYYKGRAPNGQKSDFIMHEYRLE 136
                           ********.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-555140IPR003441NAC domain
PROSITE profilePS5100551.7537148IPR003441NAC domain
PfamPF023653.5E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010981Biological Processregulation of cell wall macromolecule metabolic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0090058Biological Processmetaxylem development
GO:0005634Cellular Componentnucleus
GO:0009531Cellular Componentsecondary cell wall
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MNSLSHVPPG FRFHPTDEEL VDYYLRKKIT SRRIDLDVIK DIDLYKIEPW DLQELCRMGT  60
EEQSDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVYYKGRA  120
PNGQKSDFIM HEYRLETDPN GAPQASFP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-48613514140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400037408
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-144HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015169148.11e-104PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX27e-94NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM1BY511e-108M1BY51_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000555521e-108(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.19e-86NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]