PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400037397
Common NameLOC102599511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TCP
Protein Properties Length: 202aa    MW: 21143.9 Da    PI: 8.5087
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400037397genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.51.4e-3543120683
                   TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                           ++++++hTkv+gR+RRvR++a+caar+F+L++eLG+ +d++tieWLl++a+p+i+++tgt++++a+++++ s++   s
  PGSC0003DMP400037397  43 SSSKDRHTKVNGRGRRVRMPALCAARVFQLTKELGHRTDGETIEWLLRNAEPSIIAATGTGTIPATQVTTTSENIPLS 120
                           579**************************************************************7774444433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.1E-3044116IPR005333Transcription factor, TCP
PROSITE profilePS5136926.9014599IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MGSEIVVSGA ISGAGNGSVN SEANDKTALA VVPTKKRNAL SVSSSKDRHT KVNGRGRRVR  60
MPALCAARVF QLTKELGHRT DGETIEWLLR NAEPSIIAAT GTGTIPATQV TTTSENIPLS  120
QSQPSVLAPL TRATPVSGFP VGGGFFSMAP QSQPNCRLDL CQPSLEFSGN AYRHMPFTAL  180
LLQPVTADEG EEKVAGEDGK Q*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400037397
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006354350.11e-147PREDICTED: transcription factor TCP11
SwissprotQ9SJK78e-41TCP11_ARATH; Transcription factor TCP11
TrEMBLM1BY441e-145M1BY44_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000555411e-146(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.11e-36TCP family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]