PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400037231
Common NameLOC102583210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 563aa    MW: 64345.7 Da    PI: 4.8807
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400037231genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.42.3e-5661341129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lppGfrFhPtdeelv +yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatg
  PGSC0003DMP400037231   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPdKsLLPSKDMEWYFFSPRDRKYPNGTRTNRATKAGYWKATG 93 
                           79****************************.99**************96435566888******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           kd++v s + + +g+kktLv+y+grap+g++t Wvmheyrle
  PGSC0003DMP400037231  94 KDRKVNS-QMRPIGMKKTLVYYRGRAPHGTRTGWVMHEYRLE 134
                           ******9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.12E-634156IPR003441NAC domain
PROSITE profilePS5100561.6016156IPR003441NAC domain
PfamPF023653.7E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEVIPE VDLYKCEPWD LPDKSLLPSK  60
DMEWYFFSPR DRKYPNGTRT NRATKAGYWK ATGKDRKVNS QMRPIGMKKT LVYYRGRAPH  120
GTRTGWVMHE YRLEERECEV ANGLQDAYAL CRVFKKSLNV PKIGDHYGSD RSGCSINDQL  180
YTEGRGEDSD YGMMPTTTSS SSMLLHGSPL MNVAPAPSND DNKWMQYLSD EANFTFNNNP  240
SFPTNGPFPY NHPSKVDIAL ECARLQHRFA LPPLEVQDFP QVGYVMSQSN DVMYHQSTTN  300
QTDIVQEILS VAQASHDLTN QEYSWDGNYN NINYGDDFSF LPHNNNHDLG NSFNFMDQLK  360
EDDDQNNSIP IVDFDEDFKS ETMVERLRWV GMSQKDDKTF LEDYKTVPIE NISGPHKEEQ  420
DQLQGEASGQ QNNMNETEAN NFSLGFGNDD NFLDDEETDG FSSSPSFEVY EKIEVNQGMF  480
IATRQVANTF YHQVAPSKTV TIHRDMVTMH EFPIRKITKN ATFLDTFMAF SRKTLSGVVM  540
RVNTLVELIA PLHAFWTILG NA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-55116212171NO APICAL MERISTEM PROTEIN
1ut4_B3e-55116212171NO APICAL MERISTEM PROTEIN
1ut7_A3e-55116212171NO APICAL MERISTEM PROTEIN
1ut7_B3e-55116212171NO APICAL MERISTEM PROTEIN
3swm_A3e-55116215174NAC domain-containing protein 19
3swm_B3e-55116215174NAC domain-containing protein 19
3swm_C3e-55116215174NAC domain-containing protein 19
3swm_D3e-55116215174NAC domain-containing protein 19
3swp_A3e-55116215174NAC domain-containing protein 19
3swp_B3e-55116215174NAC domain-containing protein 19
3swp_C3e-55116215174NAC domain-containing protein 19
3swp_D3e-55116215174NAC domain-containing protein 19
4dul_A3e-55116212171NAC domain-containing protein 19
4dul_B3e-55116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400037231
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015165583.10.0PREDICTED: NAC domain-containing protein 86-like
TrEMBLM1BXQ90.0M1BXQ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000553220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-144NAC domain containing protein 28
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]