PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400036127
Common NameLOC102588193
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HB-other
Protein Properties Length: 334aa    MW: 37686.5 Da    PI: 4.7148
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400036127genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-09268315653
                           S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
              Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                           +++k qle+Le+++++++ p+ +++  + + ++++ ++V  WF  rR 
  PGSC0003DMP400036127 268 RLKKVQLETLEQVYRRSKRPTNAMISSIVHVTNVPRKRVLKWFEDRRS 315
                           57899******************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.653260320IPR001356Homeobox domain
SuperFamilySSF466892.01E-9262325IPR009057Homeodomain-like
CDDcd000866.56E-7263314No hitNo description
SMARTSM003896.0E-4266324IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.7E-8268317IPR009057Homeodomain-like
PfamPF000465.1E-7268315IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MASASTTLGI SIRLGCSSNE HLLLGQPRSR TNIALPFHSS SSRLVTFSRR RNNSAITSSN  60
KKKKSSPRKD TEEVDDIDED AFEALFQLLE EDLKNDELSL DDDDITEEDL AKLERELEEA  120
LKDDELLGEI DSIANENIES SKAEDEEAVA EDANEDDEDE DMLVKLKNWQ LKKLAYALRK  180
GRRKLNIKNL AADLCLDRAV VLEMLRNPPP NLVLLSAALP DEPVPRMLEP ESKPLETVPI  240
EMSDAAKPDA KVETPVHVMQ SNWSAQKRLK KVQLETLEQV YRRSKRPTNA MISSIVHVTN  300
VPRKRVLKWF EDRRSEEGVP AHRLPYQPSS ISE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14863RRRNNSAITSSNKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755201e-171HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
GenBankHG9754471e-171HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankAP0092651e-171AP009265.1 Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0027D09, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361722.10.0PREDICTED: protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLM1BV570.0M1BV57_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000535770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94282327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.12e-67overexpressor of cationic peroxidase 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]