PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400035655
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 134aa    MW: 14777 Da    PI: 3.8665
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400035655genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM35.92.3e-11637132
                   NAM  1 lppGfrFhPtdeelvveyLkkkvegkklelee 32
                          lppGfrFhPtd+elv +yLk+k++g ++e+e+
  PGSC0003DMP400035655  6 LPPGFRFHPTDDELVGYYLKRKTDGLEIEMEQ 37
                          79*************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-10442IPR003441NAC domain
PROSITE profilePS5100510.0546133IPR003441NAC domain
PfamPF023651.3E-8744IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MAGATLPPGF RFHPTDDELV GYYLKRKTDG LEIEMEQFPG DGTYLHYEFP NVASWQPNDR  60
IEVTSSSTSL SLRGEVELSG DLSSFGCVSP YSIHGSYTGL YDNSVMSYEG NEGWDQANLG  120
DVNGLWSDED NFQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400035655
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755204e-62HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760809.12e-41PREDICTED: protein ATAF2-like
RefseqXP_016501877.12e-41PREDICTED: NAC domain-containing protein 86-like
TrEMBLM1BU312e-93M1BU31_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000528763e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62561635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.12e-16NAC domain containing protein 71
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]