PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400034078
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 431aa    MW: 48940.6 Da    PI: 8.2563
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400034078genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.1e-49401661128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                           + pGfrF Ptdeel+++yLkkkveg++  + evi+ev+i k+ePwdLp k++ ++++ew+fFs+r +ky++g++++rat+sgyWkatgk
  PGSC0003DMP400034078  40 MFPGFRFCPTDEELISYYLKKKVEGSDKCV-EVISEVEIWKHEPWDLPgKSIVQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGK 127
                           579************************777.99***************878888999******************************** PP

                   NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +++v+s +++ +g+k+tLvf+ grapkg++t+W+mhey +
  PGSC0003DMP400034078 128 ERNVKS-GTNIIGTKRTLVFHIGRAPKGQRTQWIMHEYCM 166
                           ******.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-5637183IPR003441NAC domain
PROSITE profilePS5100553.73340184IPR003441NAC domain
PfamPF023651.0E-2642165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 431 aa     Download sequence    Send to blast
MEDEDLLDCS SEKKNGEIVE KSKISNSNGV EISVATASTM FPGFRFCPTD EELISYYLKK  60
KVEGSDKCVE VISEVEIWKH EPWDLPGKSI VQSDNEWFFF SPRGRKYPNG SQSKRATESG  120
YWKATGKERN VKSGTNIIGT KRTLVFHIGR APKGQRTQWI MHEYCMTGNP YYQDSMVVCR  180
LRKNNEFHLN DTPGNQRNHL AVTNDTVDLS RAVQLNGLRG LIDGAECCSK EASSSFSSHS  240
VEQIESGSES DKLNKELPQH HSSSYWKVLL LPLFYTARLL TSVSLYDCDE EDCFADIMKD  300
DIIKLDDSSY KARHNLLPTI TRKLESSTKS PTSQEAQNLM SNRLPFQGTA NRRLKLQTEN  360
VPRGVERSEP HEAIKKNIHA RGISRQLINI IPVKRMKQWP IPLLLVSLML LVVFLCLFGV  420
PQQVKWHYSS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-433118511169NAC domain-containing protein 19
3swm_B3e-433118511169NAC domain-containing protein 19
3swm_C3e-433118511169NAC domain-containing protein 19
3swm_D3e-433118511169NAC domain-containing protein 19
3swp_A3e-433118511169NAC domain-containing protein 19
3swp_B3e-433118511169NAC domain-containing protein 19
3swp_C3e-433118511169NAC domain-containing protein 19
3swp_D3e-433118511169NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400034078
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015158695.10.0PREDICTED: NAC domain-containing protein 40-like
TrEMBLM1BQC70.0M1BQC7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000504820.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.15e-78NTM1-like 8
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]