PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400033929
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 333aa    MW: 38213.1 Da    PI: 8.3081
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400033929genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.53.1e-54201461129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeel+++yL kkv + ++++  +i +vd++k+ePw+Lp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkd
  PGSC0003DMP400033929  20 LPPGFRFHPTDEELITHYLSKKVVDMNFSA-IAIGDVDMNKIEPWELPWKAKIGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKATGKD 107
                           79*************************999.88***************98999************************************ PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           ke+++ +++lvg+kktLvfykgrap+gekt+Wv heyrle
  PGSC0003DMP400033929 108 KEIFR-GRSLVGMKKTLVFYKGRAPRGEKTNWVTHEYRLE 146
                           *****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-6210170IPR003441NAC domain
PROSITE profilePS5100558.12620170IPR003441NAC domain
PfamPF023651.1E-2721145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MENFSGTVKM DDQQQQQMEL PPGFRFHPTD EELITHYLSK KVVDMNFSAI AIGDVDMNKI  60
EPWELPWKAK IGEKEWYFFC VRDKKYPTGL RTNRATAAGY WKATGKDKEI FRGRSLVGMK  120
KTLVFYKGRA PRGEKTNWVT HEYRLEGRLS LNNLPKTVKN DWVICRVFQK TTGGKKIHIS  180
GLVRGNSDEN EIVNSVLPPL TDSSPSHVHC FSNYVTTQKN QENNMINSFN NSPNFPLLSN  240
SIDIFQRNSL PNSFTWNQNV PLQHNFPQPG SFPIQDPATL RNLLENYGQN IQHQSFKKET  300
DMITVSQETG ISTDMNTEIT SAQQDLDCFW TY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-551717614171NO APICAL MERISTEM PROTEIN
1ut4_B2e-551717614171NO APICAL MERISTEM PROTEIN
1ut7_A2e-551717614171NO APICAL MERISTEM PROTEIN
1ut7_B2e-551717614171NO APICAL MERISTEM PROTEIN
3swm_A2e-551717617174NAC domain-containing protein 19
3swm_B2e-551717617174NAC domain-containing protein 19
3swm_C2e-551717617174NAC domain-containing protein 19
3swm_D2e-551717617174NAC domain-containing protein 19
3swp_A2e-551717617174NAC domain-containing protein 19
3swp_B2e-551717617174NAC domain-containing protein 19
3swp_C2e-551717617174NAC domain-containing protein 19
3swp_D2e-551717617174NAC domain-containing protein 19
4dul_A2e-551717614171NAC domain-containing protein 19
4dul_B2e-551717614171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400033929
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006364584.10.0PREDICTED: NAC domain-containing protein 100
SwissprotQ9FLJ21e-123NC100_ARATH; NAC domain-containing protein 100
TrEMBLM1BQ140.0M1BQ14_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000502620.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-122NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]