PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400033616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HSF
Protein Properties Length: 107aa    MW: 12032.5 Da    PI: 6.5044
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400033616genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.79.2e-253999262
                          HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
          HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
                          Fl+k+ye+++d+++++++sw++ g+sfvv+d++ f++++Lp++Fkh+nf+SFvRQ n+Y +
  PGSC0003DMP400033616 39 FLTKTYEMVDDSTIDHVVSWNRGGQSFVVWDPHAFSTTLLPRFFKHNNFSSFVRQQNTYYW 99
                          9**********************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.106.9E-2733100IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467854.9E-2335100IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.2E-2135106IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.3E-203999IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.8E-143962IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.8E-147789IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.8E-1490102IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MNQLYSVKEE FPGSSSGGKP PPPTPQPMEG LHDIGPPPFL TKTYEMVDDS TIDHVVSWNR  60
GGQSFVVWDP HAFSTTLLPR FFKHNNFSSF VRQQNTYYWT ICGLPN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d8k_B2e-153797363Heat shock factor protein 2
5d8l_B2e-153797363Heat shock factor protein 2
5d8l_D2e-153797363Heat shock factor protein 2
5d8l_F2e-153797363Heat shock factor protein 2
5d8l_H2e-153797363Heat shock factor protein 2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400033616
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755216e-88HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015165187.15e-66PREDICTED: heat stress transcription factor A-7a-like
SwissprotQ9M1V59e-37HFA7B_ARATH; Heat stress transcription factor A-7b
TrEMBLM1BPC52e-73M1BPC5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000498033e-74(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57224113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51910.14e-37heat shock transcription factor A7A
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]