PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400033524
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 162aa    MW: 18452.3 Da    PI: 10.0005
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400033524genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.55.4e-53141391128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrF Ptdeel+v+yL++kv+g++++l ++i+e+d+yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+d
  PGSC0003DMP400033524  14 LPPGFRFYPTDEELLVQYLCRKVAGHDFSL-QIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTD 101
                           79***************************9.89***************7777799********************************** PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           k +++ +g++vg+kk Lvfy g+apkg+kt+W+mheyrl
  PGSC0003DMP400033524 102 KIITT-EGRKVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                           *9999.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-618146IPR003441NAC domain
PROSITE profilePS5100554.41714154IPR003441NAC domain
PfamPF023654.2E-2715139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MGVQEMDPLT QLSLPPGFRF YPTDEELLVQ YLCRKVAGHD FSLQIIAEID LYKFDPWVLP  60
SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIITTEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLS EPTTKSGSSR VYTLSPHNLK I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-10011514154NO APICAL MERISTEM PROTEIN
1ut4_B1e-10011514154NO APICAL MERISTEM PROTEIN
1ut7_A1e-10011514154NO APICAL MERISTEM PROTEIN
1ut7_B1e-10011514154NO APICAL MERISTEM PROTEIN
3swm_A1e-10011517157NAC domain-containing protein 19
3swm_B1e-10011517157NAC domain-containing protein 19
3swm_C1e-10011517157NAC domain-containing protein 19
3swm_D1e-10011517157NAC domain-containing protein 19
3swp_A1e-10011517157NAC domain-containing protein 19
3swp_B1e-10011517157NAC domain-containing protein 19
3swp_C1e-10011517157NAC domain-containing protein 19
3swp_D1e-10011517157NAC domain-containing protein 19
4dul_A1e-10011514154NAC domain-containing protein 19
4dul_B1e-10011514154NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400033524
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754461e-120HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015081066.11e-108NAC domain-containing protein 72-like
SwissprotA0A3Q7HH641e-108JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLM1BP501e-116M1BP50_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000496651e-108(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.11e-102NAC domain containing protein 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  3. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  4. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]