PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400032661
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 490aa    MW: 55982.1 Da    PI: 4.936
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400032661genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM132.62.7e-41561822128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                           ppGfrF Ptd el+++yL++k+++ +l+  + i e++iyk++P ++ +  k ++ e+ wy F++rd+ky++g+r+ r t +gyWkatg 
  PGSC0003DMP400032661  56 PPGFRFYPTDYELIKYYLERKLANLPLQP-NKIYEMNIYKYDPDTIAAylKPTTAENVWYVFTPRDRKYPNGERPDRCTGNGYWKATGA 143
                           9*************************999.77**************85345556788******************************** PP

                   NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           d ++ + k++++g ++ Lv++ g+ pkg+ktdW+mhey +
  PGSC0003DMP400032661 144 DISIND-KNSKIGSRRALVYHIGKPPKGKKTDWIMHEYMI 182
                           *****9.8889***************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-4945209IPR003441NAC domain
PROSITE profilePS5100547.91855209IPR003441NAC domain
PfamPF023652.5E-2256181IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MENHNTSPTN NVSKDNLISA NHINELPISA VFSNKNSNGD QIMSTEDVEA LMKKFPPGFR  60
FYPTDYELIK YYLERKLANL PLQPNKIYEM NIYKYDPDTI AAYLKPTTAE NVWYVFTPRD  120
RKYPNGERPD RCTGNGYWKA TGADISINDK NSKIGSRRAL VYHIGKPPKG KKTDWIMHEY  180
MIPKIPIPNS STPRNPKLDE WVLCRFYNKN DVITTRSTRR KRKRGDDDPF IDEVHEDSTG  240
NDLTTNFNNN DNHAIMFPED QDSMRNDLTN FNNNYNHAMS LHPQVHTGLS TLPQYSYMPI  300
MSNYQNYVSD HYNNYTDGAP LPLMIKPTAT NNSIEHDYTM NNEGFGGDYG EYLEHDQHYA  360
FDQYIVDNYE SQYNTNNFVN GETTTSNNFV NCETTNSNNF INGETTTSNN FVNCETTNSN  420
NFINGETTTS NNFVNCETTN SNNFINGETT TSNNFVNCET TNSNNFINGE TTTSNNFVNG  480
ETSTSKKDC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-48432104166NO APICAL MERISTEM PROTEIN
1ut4_B1e-48432104166NO APICAL MERISTEM PROTEIN
1ut7_A1e-48432104166NO APICAL MERISTEM PROTEIN
1ut7_B1e-48432104166NO APICAL MERISTEM PROTEIN
4dul_A1e-48432104166NAC domain-containing protein 19
4dul_B1e-48432104166NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218223RRKRKR
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400032661
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0877731e-142AC087773.1 Genomic Sequence For Lycopersicon esculentum Clone T62O11, complete sequence.
GenBankAF4118081e-142AF411808.1 Lycopersicon esculentum BAC clone Clemson_Id 62O11, complete sequence.
GenBankHG9755191e-142HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010323471.10.0protein CUP-SHAPED COTYLEDON 3-like
TrEMBLM1BM460.0M1BM46_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000482370.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139361213
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15500.12e-51NAC domain containing protein 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]