PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400031815
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 405aa    MW: 46002.8 Da    PI: 6.7746
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400031815genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.75.7e-50361612128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                           +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+
  PGSC0003DMP400031815  36 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADR 123
                           79***************************.89***************8778899*********************************** PP

                   NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            + +++++ +glkktLvfy+g+apkg +++W+m+eyrl
  PGSC0003DMP400031815 124 MIRTENSRSIGLKKTLVFYSGKAPKGIRSSWIMNEYRL 161
                           ************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100556.00235182IPR003441NAC domain
SuperFamilySSF1019411.06E-5535181IPR003441NAC domain
PfamPF023654.6E-2537161IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MSQSQQQHQQ QDDDDNINNT IKGDDDDDDH EHDMVMPGFR FHPTEEELVE FYLRRKVEGK  60
RFNVELITFL DLYRYDPWEL PALAAIGEKE WYFYVPRDRK YRNGDRPNRV TTSGYWKATG  120
ADRMIRTENS RSIGLKKTLV FYSGKAPKGI RSSWIMNEYR LPHHETERLQ KAEISLCRVY  180
KRAGVEDHPS LPRSLLTTRA SSSSSSRGTT SIKKQQVQQQ DSSLISPLYL GQSSQQQIDE  240
KLSTETSASS TSTDHHHHHH HHHVATSLGL NSLSNSYTNI ALDPIGSAVN SSLNITTSTL  300
TPFTSLVATT NNTDDLHRLI NLDQVVAFHN NQHHFHPPPG VVPQQYPPLL LQQPQLAPQS  360
LLHQGSLPSS AAAAFSDRLW EWNSINQTDG SCKDDHYQDN NPFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-563718219165NO APICAL MERISTEM PROTEIN
1ut4_B4e-563718219165NO APICAL MERISTEM PROTEIN
1ut7_A4e-563718219165NO APICAL MERISTEM PROTEIN
1ut7_B4e-563718219165NO APICAL MERISTEM PROTEIN
3swm_A5e-563718222168NAC domain-containing protein 19
3swm_B5e-563718222168NAC domain-containing protein 19
3swm_C5e-563718222168NAC domain-containing protein 19
3swm_D5e-563718222168NAC domain-containing protein 19
3swp_A5e-563718222168NAC domain-containing protein 19
3swp_B5e-563718222168NAC domain-containing protein 19
3swp_C5e-563718222168NAC domain-containing protein 19
3swp_D5e-563718222168NAC domain-containing protein 19
4dul_A4e-563718219165NAC domain-containing protein 19
4dul_B4e-563718219165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400031815
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2462550.0AC246255.2 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-65j3 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358477.10.0PREDICTED: NAC domain-containing protein 55
SwissprotQ9ZVP81e-115NAC35_ARATH; NAC domain-containing protein 35
TrEMBLM1BK160.0M1BK16_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000470210.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-109NAC domain containing protein 35
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  4. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]