PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400030789
Common NameLOC102577544, WHY1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Whirly
Protein Properties Length: 275aa    MW: 30327.1 Da    PI: 9.5337
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400030789genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly216.72.2e-67972351139
                Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGk 89 
                           s+yk+kaal+v+++ p+f+ ldsg++kl+r+G ++l++a+a+++r+ydW++kq+f+ls+te++++++l++k+sceffhdp ++ s+eG+
  PGSC0003DMP400030789  97 SIYKGKAALTVEPRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSIISLGAKDSCEFFHDPNKGRSDEGR 185
                           7**************************************************************************************** PP

                Whirly  90 vrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                           vrk+lkvePlpdGsG+f+nlsv+n+l++ +e++++Pv+kaefavl s+++
  PGSC0003DMP400030789 186 VRKVLKVEPLPDGSGHFFNLSVQNKLINLDENIYIPVTKAEFAVLVSAFN 235
                           **********************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.102.2E-7985257IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-8290274IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.3E-6298232IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MSNFSLSPSP TSGFSLNLQN PTKTSYLSFS SSINTIFAPL SSNTTKSFSG LTHKAALPRN  60
LSLTCRHSDY FEPQQQQQQQ QQQPQGASTP KVFVGYSIYK GKAALTVEPR SPEFSPLDSG  120
AFKLSREGMV MLQFAPAAGV RQYDWSRKQV FSLSVTEIGS IISLGAKDSC EFFHDPNKGR  180
SDEGRVRKVL KVEPLPDGSG HFFNLSVQNK LINLDENIYI PVTKAEFAVL VSAFNFVMPY  240
LLGWHTAVNS FKPEDASRSN NANPRSGAEL EWNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1546627312219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1546627312219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1546627312219p24: plant transcriptional regulator PBF-2
1l3a_D1e-1546627312219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400030789
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2333420.0AF233342.1 Solanum tuberosum DNA-binding protein p24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275155.10.0single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9LL850.0WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A0V0HSY50.0A0A0V0HSY5_SOLCH; Putative single-stranded DNA-binding protein WHY1, chloroplastic-like
STRINGPGSC0003DMT4000454390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77312430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.21e-111ssDNA-binding transcriptional regulator
Publications ? help Back to Top
  1. Desveaux D,Despr
    PBF-2 is a novel single-stranded DNA binding factor implicated in PR-10a gene activation in potato.
    Plant Cell, 2000. 12(8): p. 1477-89
    [PMID:10948264]
  2. Desveaux D,Allard J,Brisson N,Sygusch J
    A new family of plant transcription factors displays a novel ssDNA-binding surface.
    Nat. Struct. Biol., 2002. 9(7): p. 512-7
    [PMID:12080340]
  3. Desveaux D, et al.
    A "Whirly" transcription factor is required for salicylic acid-dependent disease resistance in Arabidopsis.
    Dev. Cell, 2004. 6(2): p. 229-40
    [PMID:14960277]
  4. Desveaux D,Maréchal A,Brisson N
    Whirly transcription factors: defense gene regulation and beyond.
    Trends Plant Sci., 2005. 10(2): p. 95-102
    [PMID:15708347]
  5. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]