PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400030570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 260aa    MW: 29090 Da    PI: 8.5416
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400030570genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-5361331128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                           lppGfrFhPtdeelv +yLk+k++g ++el evi+ +d+yk++Pw+Lp k  + +++ ew+fF+ rdkky++g+r+nratksgyWkatg
  PGSC0003DMP400030570   6 LPPGFRFHPTDEELVGYYLKRKTDGLEIEL-EVIPVIDLYKFDPWELPeKsFLPKRDFEWFFFCARDKKYPNGSRTNRATKSGYWKATG 93 
                           79****************************.99***************5333344566******************************* PP

                   NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           kd++v++ + ++vg +ktLvfy+grap g +tdWvmheyrl
  PGSC0003DMP400030570  94 KDRKVVC-HPAVVGYRKTLVFYRGRAPLGDRTDWVMHEYRL 133
                           *******.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-624156IPR003441NAC domain
PROSITE profilePS5100557.5146156IPR003441NAC domain
PfamPF023652.4E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MAGTSLPPGF RFHPTDEELV GYYLKRKTDG LEIELEVIPV IDLYKFDPWE LPEKSFLPKR  60
DFEWFFFCAR DKKYPNGSRT NRATKSGYWK ATGKDRKVVC HPAVVGYRKT LVFYRGRAPL  120
GDRTDWVMHE YRLCDDVTQG TPSFQGPFAL CRVIKRNDVS LKTKDVGGVK QIGCTTSGAF  180
TSVNALSDET PTQSAYMSND SNYSTPITSP YQTTQFGDYE SAIGANSANL WMSSAMILDS  240
SKVSTLCSSF NPVSVLLLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-52516216171NO APICAL MERISTEM PROTEIN
1ut4_B3e-52516216171NO APICAL MERISTEM PROTEIN
1ut7_A3e-52516216171NO APICAL MERISTEM PROTEIN
1ut7_B3e-52516216171NO APICAL MERISTEM PROTEIN
4dul_A3e-52516216171NAC domain-containing protein 19
4dul_B3e-52516216171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400030570
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5098740.0AF509874.1 Petunia x hybrida nam-like protein 11 (NH11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352840.10.0PREDICTED: NAC domain-containing protein 45-like
SwissprotO496972e-92NAC71_ARATH; NAC domain-containing protein 71
TrEMBLM1BH490.0M1BH49_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000451290.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.18e-95NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  4. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]