PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400029635
Common NameLOC102591848
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 587aa    MW: 66246 Da    PI: 4.639
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400029635genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.41.7e-50231492128
                   NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                           ppGfrFhPtdeelv +yLkkk+ +k++ l ++i+++d+yk+eP+dLp  +k+k+++++w+fFs+rd+ky++g r+nr tk+g Wk tgk
  PGSC0003DMP400029635  23 PPGFRFHPTDEELVLYYLKKKICRKRILL-DAIADTDVYKWEPEDLPdlSKLKTGDRQWFFFSPRDRKYPNGARANRGTKRGHWKVTGK 110
                           9*************************999.99**************96559999*********************************** PP

                   NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           d+++++ ++++vg+kktLvfykgrap ge+tdWvmhey++
  PGSC0003DMP400029635 111 DRTITC-NSRAVGVKKTLVFYKGRAPVGERTDWVMHEYTM 149
                           ******.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-5816172IPR003441NAC domain
PROSITE profilePS5100554.72322172IPR003441NAC domain
PfamPF023655.6E-2623148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MKMFELSDSD SLAGFASSRN VFPPGFRFHP TDEELVLYYL KKKICRKRIL LDAIADTDVY  60
KWEPEDLPDL SKLKTGDRQW FFFSPRDRKY PNGARANRGT KRGHWKVTGK DRTITCNSRA  120
VGVKKTLVFY KGRAPVGERT DWVMHEYTMD EEELKKCQNA QDYYALYKVF KKSGSGPKNG  180
EHYGAPFREE EWADDECPSA KGFVHQDAPP VDGGLEELLN PVLMEPLSVD YDYALEQLVH  240
EEDTRSTLLD HSAKEVNFPH HSAVIAPAKE SFDLTQSGTS QLQLHEVTEV TSAPVIYEQQ  300
PHVVEEDFRE DFLEMNDLLG PEPSTQNFDN LELYVKNFDE AGPSGQNFDM PAGNFEDLQF  360
DFLDGLSEFD LFHDAPLLDD IRTTEVGQIT EPYMNNFVNG SENPASTTYI STFQHEMMNN  420
QLMYLNEGEQ TSNQLWTQDQ RFNIFNPSEA NQLVVPPATS GVVYDSILAN HPIGANQNQL  480
PNQDDGTPSW LTSQLWAFVD SIPTSPAIAA ESPVVNSAFK RMSSFSKMRI NSRNMNVVAA  540
GNTATSRSSR HSKNGLFYFS FLGILCAILC VLVGTFVDIL RRLISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-452214915140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400029635
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135490.0BT013549.1 Lycopersicon esculentum clone 132273F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006360295.10.0PREDICTED: NAC domain-containing protein 17-like
TrEMBLM1BF210.0M1BF21_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000436810.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-123NAC domain containing protein 17
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]