PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400029617
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family bZIP
Protein Properties Length: 362aa    MW: 41009.9 Da    PI: 7.9735
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400029617genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.77.9e-1177117343
                           XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNk 43 
                           ++k++rr+++NReAAr+sR RKka++++Le+   +L +  +
  PGSC0003DMP400029617  77 SDKVQRRLAQNREAARKSRMRKKAYVQQLEKSNLKLAQLEM 117
                           68****************************86655555544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-575138IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.10577121IPR004827Basic-leucine zipper domain
PfamPF001701.4E-778117IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.44E-779115No hitNo description
Gene3DG3DSA:1.20.5.1705.2E-879122No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
PfamPF141442.4E-28166238IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MSSTSTQFAP TRRMGIFEPF HHMSMWEDAF RGDIMPSVSA CMVTPANDRA DDKSGYTSSD  60
QLIPSGSEDN QAGKSVSDKV QRRLAQNREA ARKSRMRKKA YVQQLEKSNL KLAQLEMELE  120
RARQQGLYIL GSNGNMGLSS TINPGIAAFE MEYSLWVEEQ QKKNVELRNI LQSHVSEMEL  180
QLLVETVLNH YYNLFRMKVD AAKADVFYLI SGMWRTSVER FFLWIGGFKP SELINIVMPQ  240
LEPLSDQQIV KICNLRHCCQ QAEDALTQGM DKLQQTLAQN ILTMTTGMGS YSSQMVSSME  300
KLEALESFVT QADHLRQQTL QQLSLVLTTR QSARGLLAFG EYLQRLRALS SLWAARPREP  360
T*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00247DAPTransfer from AT1G77920Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400029617
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006360289.10.0PREDICTED: transcription factor TGA7
RefseqXP_015170248.10.0PREDICTED: transcription factor TGA7
SwissprotQ93ZE21e-151TGA7_ARATH; Transcription factor TGA7
TrEMBLM1BF040.0M1BF04_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000436510.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-141bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]