PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400029302
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 535aa    MW: 59573.9 Da    PI: 7.3982
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400029302genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.41.5e-33204261260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  PGSC0003DMP400029302 204 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGNHNHPK 261
                           8****************************************.***************85 PP

2WRKY105.82.3e-33376434159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYY+Cts+gCpv+k+ver+++d + v++tYeg+Hnh+
  PGSC0003DMP400029302 376 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSTGCPVRKHVERASQDIRSVITTYEGKHNHD 434
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.9E-29194262IPR003657WRKY domain
PROSITE profilePS5081124.088198262IPR003657WRKY domain
SuperFamilySSF1182909.68E-26199262IPR003657WRKY domain
SMARTSM007749.2E-37203261IPR003657WRKY domain
PfamPF031061.1E-25204260IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.0E-37361436IPR003657WRKY domain
SuperFamilySSF1182905.89E-29368436IPR003657WRKY domain
PROSITE profilePS5081138.629371436IPR003657WRKY domain
SMARTSM007743.0E-38376435IPR003657WRKY domain
PfamPF031061.1E-25377434IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 535 aa     Download sequence    Send to blast
MAASSFSFPT SSSSFMTTSF TDLLASDDYP TKGLGDRIAE RTGSGVPKFK SLPPPSLPLS  60
PPPFSPSSYF AIPPGLSPTE LLDSPVLLSS SNLLPSPTTG SFPSHAFNWK SSSHRDVKQE  120
DKNYSDFSFQ PQVGTAASIS QSQTNHVPLG QQAWNYQEPT KQNDQNANGR SEFNTLQSFM  180
QNNNDQNNSG NQYNQSIREQ KRSDDGYNWR KYGQKQVKGS ENPRSYYKCT YPNCPTKKKV  240
ERSLDGQITE IVYKGNHNHP KPQSTRRSSS STASSAIQSY NTQTNEIPDH QSYGSNGQMD  300
SVATPENSSI SFGDDDHEHT SQKSSRSRGD DLDEEEPDSK RWKRENESEG LSALGGSRTV  360
REPRVVVQTT SDIDILDDGY RWRKYGQKVV KGNPNPRSYY KCTSTGCPVR KHVERASQDI  420
RSVITTYEGK HNHDVPAARG SGNHSINRPM APTVRPTVTS HQSNYQVPLQ SIRPQQSEMG  480
APYTLEMLQR PNNYGISGYA NSGDSYENQV QDNNVFSRTK DEPRDDMFME SLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-36187437178Probable WRKY transcription factor 4
2lex_A3e-36187437178Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator (PubMed:26025535). Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (PubMed:19199048, PubMed:26025535). Negative regulator of both gibberellic acid (GA) and abscisic acid (ABA) signaling in aleurone cells, probably by interfering with GAM1, via the specific repression of GA- and ABA-induced promoters (PubMed:15618416, PubMed:19199048, PubMed:26025535). {ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048, ECO:0000269|PubMed:26025535}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400029302
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) in aleurone cells, embryos, roots and leaves (PubMed:15618416, PubMed:19199048). Slightly down-regulated by gibberellic acid (GA) (PubMed:15618416). Accumulates in response to jasmonic acid (MeJA) (By similarity). {ECO:0000250|UniProtKB:Q6B6R4, ECO:0000269|PubMed:15618416, ECO:0000269|PubMed:19199048}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4453900.0AB445390.1 Solanum tuberosum StWRKY8 mRNA for double WRKY type transfactor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001274836.10.0double WRKY type transfactor
SwissprotQ6IEQ71e-140WRK24_ORYSJ; WRKY transcription factor WRKY24
TrEMBLM1BE910.0M1BE91_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000432040.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-111WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Zhang ZL, et al.
    A negative regulator encoded by a rice WRKY gene represses both abscisic acid and gibberellins signaling in aleurone cells.
    Plant Mol. Biol., 2009. 70(1-2): p. 139-51
    [PMID:19199048]
  3. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  4. Basu S,Roychoudhury A
    Expression profiling of abiotic stress-inducible genes in response to multiple stresses in rice (Oryza sativa L.) varieties with contrasting level of stress tolerance.
    Biomed Res Int, 2014. 2014: p. 706890
    [PMID:25110688]
  5. Zhang L, et al.
    Three WRKY transcription factors additively repress abscisic acid and gibberellin signaling in aleurone cells.
    Plant Sci., 2015. 236: p. 214-22
    [PMID:26025535]