PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400029288
Common NameLOC102598645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 199aa    MW: 22448.2 Da    PI: 6.2716
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400029288genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1757.8e-5536131297
                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                           +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++ lGfedyv plk+yl+ky
  PGSC0003DMP400029288  36 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITILGFEDYVLPLKQYLSKY 124
                           89*************************************************************************************** PP

                 NF-YB  91 relegek 97 
                           relegek
  PGSC0003DMP400029288 125 RELEGEK 131
                           ****996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5130143IPR009072Histone-fold
SuperFamilySSF471137.3E-3938144IPR009072Histone-fold
PfamPF008083.5E-2841105IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-186987No hitNo description
PROSITE patternPS0068507288IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-1888106No hitNo description
PRINTSPR006151.5E-18107125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MEDERRGNCP ESSTMPTSTT LSTMSIIPNN NNNNNKEQDR FLPIANVGRI MKKVIPGNGK  60
ISKDAKETVQ ECVSEFISFV TGEASDKCQR EKRKTINGDD IIWAITILGF EDYVLPLKQY  120
LSKYRELEGE KLNVPKQNQP QQHDQKPTFS YNSVYSPTGL LPQTSFVPTD QPFPLPFSPN  180
SIQSQLPKQE HVDSMGHW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B9e-4436126292Transcription factor HapC (Eurofung)
4g92_B9e-4436126292Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400029288
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355096.11e-147PREDICTED: nuclear transcription factor Y subunit B-7
SwissprotQ9SIT97e-69NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLM1BE771e-145M1BE77_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000431761e-146(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.16e-71nuclear factor Y, subunit B7
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]