PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400028423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HSF
Protein Properties Length: 118aa    MW: 13736.6 Da    PI: 4.2909
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400028423genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.61e-243391260
                          HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
          HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                          Fl+k+ye+++d++ ++++sws+ +nsf+v+d++++a + Lp+yFkh+nf+SFvRQLn+Y
  PGSC0003DMP400028423 33 FLTKTYELVDDPSSNDVVSWSRGNNSFIVWDPQNLAINFLPRYFKHNNFSSFVRQLNTY 91
                          9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.6E-262691IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467853.54E-232892IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.5E-2229115IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.2E-143356IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004474.7E-203391IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.2E-147183IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.2E-148496IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MDDFDNLIKE EFDGSFLVPQ PKECLHENGP PPFLTKTYEL VDDPSSNDVV SWSRGNNSFI  60
VWDPQNLAIN FLPRYFKHNN FSSFVRQLNT YVSIIFIFYL YMTTIHLLIC SILYDDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d8k_B5e-173191363Heat shock factor protein 2
5d8l_B5e-173191363Heat shock factor protein 2
5d8l_D5e-173191363Heat shock factor protein 2
5d8l_F5e-173191363Heat shock factor protein 2
5d8l_H5e-173191363Heat shock factor protein 2
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400028423
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-153HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006350653.17e-62PREDICTED: heat stress transcription factor A-6b-like
SwissprotQ9LUH85e-36HFA6B_ARATH; Heat stress transcription factor A-6b
TrEMBLM1BC852e-80M1BC85_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000419443e-61(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.12e-38heat shock transcription factor A6B
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]