PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400028150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Dof
Protein Properties Length: 379aa    MW: 41171.6 Da    PI: 6.9811
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400028150genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.91.3e-392888262
                zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          ke+al+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  PGSC0003DMP400028150 28 KEQALNCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 88
                          67999*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-333086IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-263182IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4223286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MSQDNKDESQ SSGGGDGSGG GPMGARPKEQ ALNCPRCDSP NTKFCYYNNY SLSQPRHFCK  60
TCRRYWTKGG ALRNVPIGGG CRKNKKIKTS SSSSRFSGDS KDTISGSSDI GGLKFFHGLS  120
PAMDFQLGGL NFPRLSNNTS TSTVGGSIFN QFTSFGENST PNIGSTSCFS LDPSGSSLLG  180
FNNNFPFSSS MLKQGTDGVQ EMGSMGVHHG TMASSIESLS SINQDLHWKL QQQRLSMLFG  240
GENQKENIVS SSIPLHDDQN QNQNQNQIQI QKPQPILFQN LEISSSKQQE DHQETFGNNN  300
VDSRKDCSTT MGSHHGNNLS TEWFFDNSFG VNPNSTNSNN NNNNNGNGNA NANDDQNVNN  360
WNSTIQAWSN LNQYSTLP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400028150
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754500.0HG975450.1 Solanum pennellii chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006353273.10.0PREDICTED: dof zinc finger protein DOF5.7
TrEMBLM1BBK00.0M1BBK0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000415800.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-54Dof family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]