PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400026135
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 329aa    MW: 37403.1 Da    PI: 10.1405
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400026135genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.92.3e-54101391128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeel+++yL +k+++ +++  ++i++vd++k+ePwdLp k+k + kewyfFs rd+ky+tg r+nrat+sgyWk+tgkd
  PGSC0003DMP400026135  10 LPPGFRFHPTDEELITYYLVNKINDVNFTG-RAIADVDLNKSEPWDLPGKAKMGGKEWYFFSLRDRKYPTGVRTNRATNSGYWKTTGKD 97 
                           79*************************999.88***************999999*********************************** PP

                   NAM  90 kevlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ke++++   ++elvg+kktLvfykgrap+gek++Wvmheyr+
  PGSC0003DMP400026135  98 KEIFNSknnNSELVGMKKTLVFYKGRAPRGEKSNWVMHEYRI 139
                           ****987767777***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-645161IPR003441NAC domain
PROSITE profilePS5100561.09710161IPR003441NAC domain
PfamPF023651.1E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MEEVKEETQL PPGFRFHPTD EELITYYLVN KINDVNFTGR AIADVDLNKS EPWDLPGKAK  60
MGGKEWYFFS LRDRKYPTGV RTNRATNSGY WKTTGKDKEI FNSKNNNSEL VGMKKTLVFY  120
KGRAPRGEKS NWVMHEYRIR SKSSYKTNKQ DEWVVCRIFQ KSVGLKKYPT NQYSRATYSL  180
NNTQNNASIM PSQMMQLPHD HQGFQFAMGR NNNNYMNNHG HEIQDLNNRV IFQSGSSNMI  240
NNFPIQPQMS YNIGGGSTSS GAGGGDNNNN YFSISGLNLN LGGGVVASSQ PIFRPMPTPT  300
PTPPPPPPPP PRHMYHHNLW VNKKWLLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-54716717174NAC domain-containing protein 19
3swm_B3e-54716717174NAC domain-containing protein 19
3swm_C3e-54716717174NAC domain-containing protein 19
3swm_D3e-54716717174NAC domain-containing protein 19
3swp_A3e-54716717174NAC domain-containing protein 19
3swp_B3e-54716717174NAC domain-containing protein 19
3swp_C3e-54716717174NAC domain-containing protein 19
3swp_D3e-54716717174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00277DAPTransfer from AT2G24430Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400026135
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754471e-141HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006357022.20.0PREDICTED: NAC domain-containing protein 100-like
TrEMBLM1B6X00.0M1B6X0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000384640.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.21e-102NAC domain containing protein 38