PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400025796
Common NameLOC102582547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 179aa    MW: 20416.9 Da    PI: 5.4004
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400025796genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB171.21.2e-5331126297
                 NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 
                           +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wal++lGf+dyveplk yl+k+
  PGSC0003DMP400025796  31 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHNEKRKTLNGDDICWALGSLGFDDYVEPLKRYLHKH 119
                           79*************************************************************************************** PP

                 NF-YB  91 relegek 97 
                           relege+
  PGSC0003DMP400025796 120 RELEGER 126
                           ****996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.7E-5230149IPR009072Histone-fold
SuperFamilySSF471131.23E-4033151IPR009072Histone-fold
PfamPF008082.8E-2736100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.6E-196482No hitNo description
PROSITE patternPS0068506783IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.6E-1983101No hitNo description
PRINTSPR006157.6E-19102120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MVDNNINILG SKYDKESSNY NSISEDGLIY KEQDRLLPIA NVGRIMKQIL PPNAKISKEA  60
KETMQECVSE FISFVTGEAS DKCHNEKRKT LNGDDICWAL GSLGFDDYVE PLKRYLHKHR  120
ELEGERINQS KGVGFGNNIE DNQRERDDEL TQRGSTIPFK ITIMDRKGEN NFLPTRPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4331121292Transcription factor HapC (Eurofung)
4g92_B3e-4331121292Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400025796
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355798.11e-131PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822481e-57NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM1B6581e-129M1B658_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000379581e-130(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.15e-60nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]