PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400024921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family LFY
Protein Properties Length: 127aa    MW: 14139.1 Da    PI: 9.9138
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400024921genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY251.53.7e-772108280386
               FLO_LFY 280 kvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiW 368
                           +vtnqvfryakkagasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvGawrqacykplvaiaarqgwdida+fnahprL+iW
  PGSC0003DMP400024921   2 QVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGAWRQACYKPLVAIAARQGWDIDAIFNAHPRLAIW 90 
                           69*************************************************************************************** PP

               FLO_LFY 369 YvPtkLrqLChlerskas 386
                           YvPtkLrqLCh ers+a+
  PGSC0003DMP400024921  91 YVPTKLRQLCHSERSNAA 108
                           ***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.9E-762108IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MQVTNQVFRY AKKAGASYIN KPKMRHYVHC YALHCLDEDA SNALRRAFKE RGENVGAWRQ  60
ACYKPLVAIA ARQGWDIDAI FNAHPRLAIW YVPTKLRQLC HSERSNAAAA ASSSVSGGVA  120
DHLPHF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A4e-70111757173PROTEIN LEAFY
2vy2_A4e-70111757173PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for the specification of floral meristem identity.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400024921
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0623570.0EF062357.1 Solanum tuberosum LEAFY/FLORICAULA (LFY) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234388.13e-87FLORICAULA/LEAFY-like protein
RefseqXP_019068135.13e-87FLORICAULA/LEAFY-like protein isoform X1
SwissprotO226211e-75ALF_PETHY; Protein ALF
TrEMBLA0A3Q7FS984e-86A0A3Q7FS98_SOLLC; Uncharacterized protein
TrEMBLM1B4602e-89M1B460_SOLTU; Uncharacterized protein
STRINGSolyc03g118160.1.13e-86(Solanum lycopersicum)
STRINGPGSC0003DMT4000367493e-90(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.14e-72floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Souer E, et al.
    Genetic control of branching pattern and floral identity during Petunia inflorescence development.
    Development, 1998. 125(4): p. 733-42
    [PMID:9435293]