PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400023877
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NF-YB
Protein Properties Length: 162aa    MW: 18179.2 Da    PI: 4.4994
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400023877genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB96.32.6e-301791795
                 NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                          m+ + P + kis+dak t+ ec+sefi fvt ea+ +cqre+r+ti+ +d+ w + ++Gf+dy+epl +y+ +yre +g
  PGSC0003DMP400023877  1 MHSTHPPHVKISDDAKRTMYECISEFICFVTYEANAHCQREQRNTITDEDVHWVINKFGFDDYIEPLPLYFPRYREDDG 79
                          5667899********************************************************************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.3E-26181IPR009072Histone-fold
PfamPF008081.4E-13155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471135.37E-22581IPR009072Histone-fold
PRINTSPR006158.5E-71937No hitNo description
PRINTSPR006158.5E-73856No hitNo description
PRINTSPR006158.5E-75775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MHSTHPPHVK ISDDAKRTMY ECISEFICFV TYEANAHCQR EQRNTITDED VHWVINKFGF  60
DDYIEPLPLY FPRYREDDGG KCGSLIGQSL LKRAMVDTAS SCNITPYHLP PNFPMARQNL  120
LYPPPMGNGD LQGDASNGST SQFVVTSVDS DVESPTEEDK E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A6e-311762297NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400023877
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-151HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015168349.11e-119PREDICTED: nuclear transcription factor Y subunit B-8-like
TrEMBLM1B1U61e-119M1B1U6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000351191e-119(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14016414
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-32nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]