PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400023525
Common NameLOC102600271
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family Trihelix
Protein Properties Length: 390aa    MW: 44073.6 Da    PI: 4.8452
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400023525genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.12.7e-24277360186
              trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                           rW+k+ev+aL+ +r+ +++++ +g +k+  Weev++ + + g+ r++k+Ckekwen+nk+yk++ ++ k r +++ ++cpyf++l+
  PGSC0003DMP400023525 277 RWPKSEVQALVSVRTCLDHKFLKG-AKGSVWEEVADGLGKMGYIRTAKKCKEKWENINKYYKRTIDSGKTR-PKNYRSCPYFHELD 360
                           8**********************9.99******************************************98.888899******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.097270333IPR017877Myb-like domain
PfamPF138373.8E-19276362No hitNo description
CDDcd122038.02E-21276339No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MEPLIDGDGH TSNDITSFAD NLAPFPESTN VVYENPSAVI APTDIHRLPV SPVRKLRPVR  60
FGNGRNYVDM VDSNCDIDEA LMTCTSDLGF LSQFSAQNAS TVLPMECGFV NSLDENGVAR  120
CSEAEISAVQ QMKSELDADC LNLISQSRIL EADFSSSSDD SEEHLPRKSL KLSLEDMVKK  180
LMDRQEQMHK QLIEMLEKKE EERIIREEAW KQQEVERARR DVELRAEETS RNLALIAFLE  240
NLLGEDFQIP KSSEVTSVVK DEGEVHGDIR SDPCNRRWPK SEVQALVSVR TCLDHKFLKG  300
AKGSVWEEVA DGLGKMGYIR TAKKCKEKWE NINKYYKRTI DSGKTRPKNY RSCPYFHELD  360
SLYKKGLLNQ GAGNCVKIET ENKNVDPEE*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00552DAPTransfer from AT5G47660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352450.10.0PREDICTED: trihelix transcription factor GT-2
TrEMBLM1B1000.0M1B100_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000346070.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128841620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47660.14e-41Trihelix family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]