PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400021824
Common NameLOC102577511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TALE
Protein Properties Length: 634aa    MW: 71384.2 Da    PI: 6.7543
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400021824genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17e-094144511954
                           HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  PGSC0003DMP400021824 414 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 451
                           554459******************************88 PP

2BELL116.99.5e-38275343472
                  BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                           elqk+k+kLl++leeVd+rYk+y++q+++v+ssFeavag g+a++Y +lA++a+SrhFrcL+d i+ qi
  PGSC0003DMP400021824 275 ELQKRKTKLLQMLEEVDRRYKHYCDQMKAVVSSFEAVAGNGAATVYSALASRAMSRHFRCLRDGIVAQI 343
                           89*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-52213341IPR006563POX domain
PfamPF075261.0E-44219339IPR006563POX domain
PROSITE profilePS5007112.082392455IPR001356Homeobox domain
CDDcd000862.51E-11395456No hitNo description
SMARTSM003895.8E-9395459IPR001356Homeobox domain
SuperFamilySSF466895.56E-17396461IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27398461IPR009057Homeodomain-like
PfamPF059208.4E-18412451IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MASHHQESIR EEIKPRSSSM VTSTGYWFSS DTNNPNPTPH NMVNHQLQNF ETNPEMYNLS  60
STTSSMDQMI GFPPNNNNPH HVLWKGNFLN KINGVDDDDD HGPSSSKNIS EQFYQHGSHE  120
NMLTTTTTHH DDHQGSWHHD NNRTLLVDDP SMRCVFPCEG NERPSQGLSL SLCSSNPPSI  180
GLQSFELRHQ DLQQGLIHDG FLGKSTNIQQ GYFHHHHQVR DSKYLGPAQE LLSEFCSLGI  240
KKNNDHSSSK VLLKQHESTA STSKKQLLQS LDLLELQKRK TKLLQMLEEV DRRYKHYCDQ  300
MKAVVSSFEA VAGNGAATVY SALASRAMSR HFRCLRDGIV AQIKATKMAM GEKDSTSTLI  360
PGSTRGETPR LRLLDQTLRQ QKAFQQMNMM ETHPWRPQRG LPERSVSVLR AWLFEHFLHP  420
YPSDVDKHIL ARQTGLSRSQ VSNWFINARV RLWKPMVEEM YIEETKEEEN VGSPDGSKAL  480
IDDMTIHQSH IDHHQDQKPN LVRIDSECIS SIINHHPHEK NDQNYGVIRG GDQSFGAIEL  540
DFSTNIAYGT SGGDHHHHGG GVSLTLGLQQ HGGSGGSSMG LTTFSSQPSH NQSSLFYPRD  600
DDQVQYTSLL DSENQNLPYR NLMGAQLLHD LAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-15401459563Homeobox protein Meis2
3k2a_B1e-15401459563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4067000.0AF406700.1 Solanum tuberosum BEL1-related homeotic protein 14 (Bel14) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343945.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-142BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLM1AWW90.0M1AWW9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000321220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-101TALE family protein
Publications ? help Back to Top
  1. Chen H,Rosin FM,Prat S,Hannapel DJ
    Interacting transcription factors from the three-amino acid loop extension superclass regulate tuber formation.
    Plant Physiol., 2003. 132(3): p. 1391-404
    [PMID:12857821]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]