PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400021708
Common NameLOC102605272
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 656aa    MW: 73486.2 Da    PI: 6.8552
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400021708genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.42.7e-23128228198
                           EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                    B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                           f+kvlt sd++++g +++ +k+a+e+       +++++  ++l+ +d++  +W +k+i+r++++r++lt+GW++Fv++++L +gD++vF
  PGSC0003DMP400021708 128 FCKVLTASDTSTHGGFSVLRKHANEClppldmnQQIPT--QELIAKDLHDMEWHFKHIFRGQPRRHLLTTGWSNFVSSKRLVAGDSFVF 214
                           99****************************97544444..48*********************************************** PP

                           EE-SSSEE..EEEEE- CS
                    B3  83 kldgrsefelvvkvfr 98 
                              + +++el+v+v+r
  PGSC0003DMP400021708 215 L--RGDNGELRVGVRR 228
                           *..3489999****98 PP

2Auxin_resp981.3e-32254333183
            Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                           a+ha++t++ F v+Y+Pr+  ++F+v+++k+++a+++ +svGmRfkm+fe e+ + rr++Gt+vgv dl++ +W++S WrsLk
  PGSC0003DMP400021708 254 ASHAVTTQTLFVVYYKPRT--TQFIVSLNKYLEAVNHGYSVGMRFKMQFEAEENPDRRFMGTIVGVDDLSS-QWKDSAWRSLK 333
                           689***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.4E-41116257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.2E-41121243IPR015300DNA-binding pseudobarrel domain
CDDcd100171.13E-21126228No hitNo description
PfamPF023625.2E-21128228IPR003340B3 DNA binding domain
SMARTSM010194.8E-22128230IPR003340B3 DNA binding domain
PROSITE profilePS5086311.702128230IPR003340B3 DNA binding domain
PfamPF065071.0E-30254333IPR010525Auxin response factor
PfamPF023093.0E-10552647IPR033389AUX/IAA domain
SuperFamilySSF542777.46E-11557637No hitNo description
PROSITE profilePS5174520.053561642IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
MASKNGCYQS QQKKNSSGKD DLYHELWQLC AGPIVDVPKE GESVYYFPQG HMEQLVASIN  60
QEMDQRVPSF NLKSKILCRV INSHFLAEED NDEVYVQITL MPEAPDKAEP TNPDPFLPEP  120
VKPKVHSFCK VLTASDTSTH GGFSVLRKHA NECLPPLDMN QQIPTQELIA KDLHDMEWHF  180
KHIFRGQPRR HLLTTGWSNF VSSKRLVAGD SFVFLRGDNG ELRVGVRRLV RQQSSMPSSV  240
ISSQSMHLGV LATASHAVTT QTLFVVYYKP RTTQFIVSLN KYLEAVNHGY SVGMRFKMQF  300
EAEENPDRRF MGTIVGVDDL SSQWKDSAWR SLKVRWDEPA AIARPDRVSP WEIEPYVSSI  360
PNALVPPTAG KNKRHRLHSE IKISEPASSI ASAVWNPSLD SPQFNTSGIN SSTNCTLTSR  420
TESGWPLPHL NTAGMLVDET EDSRSASTWC GFPCVLAPQF GQGTNQPIVI PTDERKCNTK  480
TTCRLFGIDL KKTSISTTEA LLPPQPADIS RVSAERAPPN MAPAGDSDQK SDLSVDFKDQ  540
MQGHLRLPLK EVQSKQSCST RSRTKVQMQG VAVGRAVDLT ILKGYNELTK ELEEMFEIQG  600
ELQSRQKWGI LFTDDEGDTM LMDDYPWQDF CNVARKIFIC SSQDMKKLTL SRADS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-173153556354Auxin response factor 1
4ldw_A1e-173153556354Auxin response factor 1
4ldw_B1e-173153556354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400021708
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0136390.0BT013639.1 Lycopersicon esculentum clone 132441R, mRNA sequence.
GenBankHM0372500.0HM037250.1 Solanum lycopersicum cultivar Zhongshu No. 6 auxin response factor 9 (ARF9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343828.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLM1AWK90.0M1AWK9_SOLTU; Auxin response factor
STRINGPGSC0003DMT4000319650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]