PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400021205
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 581aa    MW: 65210.8 Da    PI: 6.5554
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400021205genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.63.1e-24198251155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           k+r++Wt +LH++Fv+av+++ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  PGSC0003DMP400021205 198 KARVVWTVDLHQKFVKAVNHI-GFDKVGPKKILDLMGVPWLTRENVASHLQKYRL 251
                           68*******************.9*******************************8 PP

2Response_reg76.78.1e-26241321109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl+vdD+p+ +++l+++l+k  y +v+++  ++eal+ l+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + 
  PGSC0003DMP400021205  24 VLVVDDDPTWLKILEKMLKKCSY-QVTTCGLAREALHVLRERKdgFDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVM 110
                           89*********************.***************999999**********************6644.8**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + ++  a d+l Kp+ ++el++
  PGSC0003DMP400021205 111 KGVQHRACDYLLKPIRMKELRN 132
                           *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23003.5E-4421152No hitNo description
SuperFamilySSF521729.11E-3521146IPR011006CheY-like superfamily
SMARTSM004482.6E-3022134IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.49623138IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.3E-2324133IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.42E-2925138No hitNo description
SuperFamilySSF466892.87E-17196255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-27196256IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-22198251IPR006447Myb domain, plants
PfamPF002498.7E-8200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MENSKTSAGF SSPRTDTFPA GLRVLVVDDD PTWLKILEKM LKKCSYQVTT CGLAREALHV  60
LRERKDGFDI VISDVNMPDM DGFKLLEHVG LEMDLPVIMM SVDGETSRVM KGVQHRACDY  120
LLKPIRMKEL RNIWQHVLRK KMQEARDAGN HELDQYDEVW MLNGAEILSG KKRKDFENKH  180
DEIEMSDSRF VDSSSMKKAR VVWTVDLHQK FVKAVNHIGF DKVGPKKILD LMGVPWLTRE  240
NVASHLQKYR LYLTRLQKED EAKDSFGGMK HPDVSSQEIC SSLSLQNPVD VYTDVTNDKY  300
VCVSGDKAIV QNGKSNIYES KVKGVVSVPA AEAKSVIEDN FDSQTAGSKI GLKDSFGLVN  360
TDVKSSKVPT PYCSTGEAPQ PQYKQQDFKP HFQSANGLSH QPLPVVSHQI PVDRTQVTCF  420
VNHIPSHEER DRHPDTRNKP SFFKTKNGVG KFSPVESNVN LFQPVSHQQT NFHTLEQMPS  480
TTWRATSHNV VNGSQSSLGN LTLRSGSIVA SVGEEIFGAS VQGECFLANN GLPNIEQFDY  540
NDPQPISGVP TYLYDTLRFD YEYPIDSLEG NMMDQGLFIV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-18194256163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400021205
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755170.0HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341767.10.0PREDICTED: two-component response regulator ARR11 isoform X1
RefseqXP_006341768.10.0PREDICTED: two-component response regulator ARR11 isoform X2
TrEMBLM1AVF10.0M1AVF1_SOLTU; Two-component response regulator
STRINGPGSC0003DMT4000312600.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67882433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-124response regulator 11
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]