PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400019955
Common NameLOC102584189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 314aa    MW: 36236.4 Da    PI: 6.6735
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400019955genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.16.9e-53151431128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPt+eel+++yLkkkv+++k++l +vi+evd++k+ePwd++ k+k     +++wyfFs++dkky+tg+r+nrat++g+Wkat
  PGSC0003DMP400019955  15 VPPGFRFHPTEEELLQYYLKKKVANEKIDL-DVIQEVDLNKLEPWDIQDKCKIgstPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKAT 102
                           69****************************.9***************954444122455****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           g+dk ++s +++ +g++ktLvfykgrap+g+k+dW+mheyr+
  PGSC0003DMP400019955 103 GRDKVIYS-NSRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRF 143
                           ********.9999***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-5910166IPR003441NAC domain
PROSITE profilePS5100557.40615166IPR003441NAC domain
PfamPF023654.7E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MPEEMSISVN GQSQVPPGFR FHPTEEELLQ YYLKKKVANE KIDLDVIQEV DLNKLEPWDI  60
QDKCKIGSTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NSRRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRFDDHITTI ASTQEEGWVI CRIFKKKNHV KSFETTSQSI  180
SNTRLYPNDE GPLEQLLHYM RSSTCKEENH VMMNNYHDTN FHDKFMQLPN LDTPSGHPNS  240
CEGELNNWIA VDRLVASHLN GQTINDYDHQ YNTNILGAAT SNHDYQQDQC DLWSFATVSS  300
TNDSLCHVSN GMI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-531217117173NAC domain-containing protein 19
3swm_B6e-531217117173NAC domain-containing protein 19
3swm_C6e-531217117173NAC domain-containing protein 19
3swm_D6e-531217117173NAC domain-containing protein 19
3swp_A6e-531217117173NAC domain-containing protein 19
3swp_B6e-531217117173NAC domain-containing protein 19
3swp_C6e-531217117173NAC domain-containing protein 19
3swp_D6e-531217117173NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400019955
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869441e-162JQ686944.1 Nicotiana tabacum cultivar SR1 NAC secondary wall thickening promoting factor 3 (NST3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015166445.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-114NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM1ASL30.0M1ASL3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000293210.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-106NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  4. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  5. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  6. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  7. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  8. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]