PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400018183
Common NameLOC102596236
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 278aa    MW: 32263.2 Da    PI: 5.594
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400018183genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.23.4e-49101381129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+++k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd
  PGSC0003DMP400018183  10 LPPGFRFYPSDEELVCHYLFKKIANEDVLK-GTLIEIDLHTCEPWQLPEMAKLNSSEWYFFSFRDRKYATGFRTNRATISGYWKATGKD 97 
                           79************************9655.6799*************88888999********************************* PP

                   NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                           ++v++  +++ vg++ktLvfy +rap+g kt W+mhe+rle
  PGSC0003DMP400018183  98 RTVVDPkTRTIVGMRKTLVFYMNRAPNGIKTGWIMHEFRLE 138
                           *****855667***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-608156IPR003441NAC domain
PROSITE profilePS5100557.08210156IPR003441NAC domain
PfamPF023654.4E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLFK KIANEDVLKG TLIEIDLHTC EPWQLPEMAK  60
LNSSEWYFFS FRDRKYATGF RTNRATISGY WKATGKDRTV VDPKTRTIVG MRKTLVFYMN  120
RAPNGIKTGW IMHEFRLENP HIPPKEDWVL CRVFHKAKAE NNNNNNNNNI FNTQNMYEVG  180
VNSSPNMDQS HIALPYAAFS QRQVGHQSQK LFDLMEPNNN QSSYVQLMSQ EMKEPQSNDE  240
MAEDDDEYGF LLDMNFEDPN LQDGSRSTAF EHWEHVI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-49915616165NO APICAL MERISTEM PROTEIN
1ut4_B5e-49915616165NO APICAL MERISTEM PROTEIN
1ut7_A5e-49915616165NO APICAL MERISTEM PROTEIN
1ut7_B5e-49915616165NO APICAL MERISTEM PROTEIN
3swm_A7e-49915619168NAC domain-containing protein 19
3swm_B7e-49915619168NAC domain-containing protein 19
3swm_C7e-49915619168NAC domain-containing protein 19
3swm_D7e-49915619168NAC domain-containing protein 19
3swp_A7e-49915619168NAC domain-containing protein 19
3swp_B7e-49915619168NAC domain-containing protein 19
3swp_C7e-49915619168NAC domain-containing protein 19
3swp_D7e-49915619168NAC domain-containing protein 19
4dul_A5e-49915616165NAC domain-containing protein 19
4dul_B5e-49915616165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400018183
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-128HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006351666.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE62e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM1ANH80.0M1ANH8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000266440.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.19e-93NAC domain containing protein 74
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  6. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  7. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]