PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400018036
Common NameLOC102585011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family G2-like
Protein Properties Length: 349aa    MW: 40689.8 Da    PI: 9.4907
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400018036genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.1e-3270123255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           prlrWtp+LH++Fv+a+e+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  PGSC0003DMP400018036  70 PRLRWTPDLHRSFVHAIERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 123
                           8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-2966124IPR009057Homeodomain-like
PROSITE profilePS5129411.6466126IPR017930Myb domain
SuperFamilySSF466891.2E-1470124IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-2370125IPR006447Myb domain, plants
PfamPF002491.7E-871122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MAENNSVEYI MEKASSSSID LNEDNKGELE EEEEVIEVED SSEKEIEGNY NTSSDVEKKN  60
VRQYVRSKFP RLRWTPDLHR SFVHAIERLG GQERATPKLV LQMMNVRGLS IAHVKSHLQM  120
YRSKKLDESG QVLGRGNNRS MQGRSYFFRN HLGGQRYNPI QDFKMKNGAI VLARNFNYDN  180
HALKSHSFSR PSYQAKNIFS RYLPWSSDNQ GSLLNSKFQK GEDLLRMKSW QTPRQVVIEQ  240
NGIMPIRSTQ FLEQKKFIPN QWEEKTAKNS HFLLQENLGQ PYSKWNCRNN ALDQNLVTPC  300
RIKMKEDKSG FEEKEWLPDL QLRLSRSTDD KINEKRMDQS DINTMLSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-1871125458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-1871125458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-1871125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-1871125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-1871125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-1871125357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-1871125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-1871125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-1871125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-1871125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-1871125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-1871125458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400018036
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-146HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006362389.10.0PREDICTED: uncharacterized protein LOC102585011
TrEMBLM1AN520.0M1AN52_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000264190.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-37G2-like family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]