PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400017509
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 356aa    MW: 40438.6 Da    PI: 6.9302
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400017509genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.71.3e-54221501128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGfrFhPtdeel+++yL+ kv + ++++   i++vd++++ePw+Lp+ +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd
  PGSC0003DMP400017509  22 LPPGFRFHPTDEELITFYLASKVFNATFSAGIQIPQVDLNRCEPWELPEVAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKATGKD 110
                           79****************************778***************8888999********************************** PP

                   NAM  90 kevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +ev+s+ +g+l g+kktLvfykgrap+gekt+Wvmheyrl
  PGSC0003DMP400017509 111 REVYSAtNGALLGMKKTLVFYKGRAPRGEKTKWVMHEYRL 150
                           ****9978899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6314172IPR003441NAC domain
PROSITE profilePS5100559.67522172IPR003441NAC domain
PfamPF023658.6E-2823150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MLAMEEILCE LNREEMMNEQ GLPPGFRFHP TDEELITFYL ASKVFNATFS AGIQIPQVDL  60
NRCEPWELPE VAKMGEREWY FFSLRDRKYP TGLRTNRATG AGYWKATGKD REVYSATNGA  120
LLGMKKTLVF YKGRAPRGEK TKWVMHEYRL DGDFSYRYSS KEEWVICRIL HKVGEKKNAI  180
YEGAGGGGGS TYPTLKTWSS SAAVNSPLTT NPKTLQISHN NHYLFQHHEN DLLKSLFNVS  240
QTTNLLPMNN NVAFSSTKRY KDNKQEEEDM TNKNSSNSVV INQQICMKSS QGNYLSSPLC  300
YNNNDQNDAF VMNNSDWSSS LAGMEEGIIP CNYFNNVVMD NCPIKIAAES WPLHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-50111726165NO APICAL MERISTEM PROTEIN
1ut4_B2e-50111726165NO APICAL MERISTEM PROTEIN
1ut7_A2e-50111726165NO APICAL MERISTEM PROTEIN
1ut7_B2e-50111726165NO APICAL MERISTEM PROTEIN
3swm_A2e-50111729168NAC domain-containing protein 19
3swm_B2e-50111729168NAC domain-containing protein 19
3swm_C2e-50111729168NAC domain-containing protein 19
3swm_D2e-50111729168NAC domain-containing protein 19
3swp_A2e-50111729168NAC domain-containing protein 19
3swp_B2e-50111729168NAC domain-containing protein 19
3swp_C2e-50111729168NAC domain-containing protein 19
3swp_D2e-50111729168NAC domain-containing protein 19
4dul_A2e-50111726165NAC domain-containing protein 19
4dul_B2e-50111726165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400017509
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF4393740.0JF439374.1 Solanum chacoense cup-shaped cotlyedon 3 (CUC3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001275002.10.0CUP-SHAPED COTYLEDON3
SwissprotQ9S8519e-97NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLM1ALV60.0M1ALV6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000256900.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.12e-99NAC family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  3. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  4. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  5. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  6. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]