PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400017075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 325aa    MW: 37121.4 Da    PI: 7.3192
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400017075genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.5e-54111401128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkat
  PGSC0003DMP400017075  11 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIREVDLNKLEPWDLKEicRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKAT 98 
                           69****************************.9***************954555442556****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           g+dk+++ ++++ +g++ktLvfy+grap+g+ktdW+mheyrl
  PGSC0003DMP400017075  99 GRDKAIYLSNSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRL 140
                           ****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-606160IPR003441NAC domain
PROSITE profilePS5100558.23411160IPR003441NAC domain
PfamPF023654.1E-2812140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MSGSANGHLS VPPGFRFHPT DEELLYYYLR KKVSYEAIDL DVIREVDLNK LEPWDLKEIC  60
RIGSGPQNEW YFFSHKDKKY PTGTRTNRAT TAGFWKATGR DKAIYLSNSK RIGMRKTLVF  120
YTGRAPHGQK TDWIMHEYRL DDNNAEVEEE GWVVCRVFKK KNYTRGFQHD IGDQDHEEQL  180
PFTDHMKAGS SKQNIQTAAS CYDNYQSSFD GSMHLPQLLS PDLTLPCPSL ISPLSNHIEC  240
STTHHNHNLL RLTSTSGPNF NFSQQHDKFS GDWSFLDKLL ASSNQGVALQ SQAATTDLVN  300
PTSSQKYPIF HHHTFDHDLL KFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-50816214167NO APICAL MERISTEM PROTEIN
1ut4_B8e-50816214167NO APICAL MERISTEM PROTEIN
1ut7_A8e-50816214167NO APICAL MERISTEM PROTEIN
1ut7_B8e-50816214167NO APICAL MERISTEM PROTEIN
3swm_A8e-50816217170NAC domain-containing protein 19
3swm_B8e-50816217170NAC domain-containing protein 19
3swm_C8e-50816217170NAC domain-containing protein 19
3swm_D8e-50816217170NAC domain-containing protein 19
3swp_A8e-50816217170NAC domain-containing protein 19
3swp_B8e-50816217170NAC domain-containing protein 19
3swp_C8e-50816217170NAC domain-containing protein 19
3swp_D8e-50816217170NAC domain-containing protein 19
4dul_A8e-50816214167NAC domain-containing protein 19
4dul_B8e-50816214167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:19081078, ECO:0000269|PubMed:20197506}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400017075
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755241e-142HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015163084.10.0PREDICTED: NAC domain-containing protein 76 isoform X2
SwissprotQ9MA171e-112SMB_ARATH; Protein SOMBRERO
TrEMBLM1AKX20.0M1AKX2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000250260.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-104NAC family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Fendrych M, et al.
    Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis.
    Curr. Biol., 2014. 24(9): p. 931-40
    [PMID:24726156]
  3. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]
  4. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  5. Kamiya M, et al.
    Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis.
    Development, 2016. 143(21): p. 4063-4072
    [PMID:27803060]