PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400015916
Common NameLOC102597958
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 396aa    MW: 44736.4 Da    PI: 6.3512
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400015916genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.77.2e-92233931374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaalklf 84 
                           lv+lLl++Ae v++++++la++l++r    as +g+p+qRl +yf++AL++r+ rs+ +   + + ++    +     s  +  a+ + 
  PGSC0003DMP400015916  23 LVHLLLAAAEEVNNQQFHLASKLISRCMWVASDSGNPVQRLSFYFAKALEERIDRSTGRYTCTDEDRHL---KyiktmSLGTNYAFLTC 108
                           68*****************************************************33333222222222...11222223333333448 PP

                  GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeel 172
                           +++ P+ ++ +++  q+I+e v +++++H iDf+i  G+QW+ L+qaLa++  ++   l+iT+vgs   ++ke+ e t + L++fA++l
  PGSC0003DMP400015916 109 HKLIPFSQVMQFAGVQTIVENVRSAKKIHLIDFNIRSGIQWIVLIQALAEKGdSPIELLKITAVGS---TEKENFEVTSNTLHSFAKSL 194
                           99************************************************98344559********...5799**************** PP

                  GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                           g++f+f+++ +++++d++ e+ ++k++E++aV +   l ++l ++ +l++    ++k+v+s+ P+++vv e ea+hns+sFl+rf+e+l
  PGSC0003DMP400015916 195 GLSFSFDIVFVSDMKDFKKESVNIKTDETVAVYCNSVLRTMLLRPDCLDN----LMKVVRSIGPTIIVVGEVEANHNSPSFLNRFIETL 279
                           *****************************************977777766....*********************************** PP

                  GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgy 349
                           ++ysa+fd++e  + r s  r+++E +++g+ i+n+va+eg++r+ r+ +le Wr+ + ++G+ + +lse+a  qa+l+l++++ +   
  PGSC0003DMP400015916 280 YFYSAFFDCFEDCMDRGSPCRTTIEGVYFGEGIRNIVAAEGEDRFTRNVKLEVWRAFFARFGMVEEELSESAWYQAHLILKQFGqGSSC 368
                           ************************************************************************************77779 PP

                  GRAS 350 rveeesgslvlgWkdrpLvsvSaWr 374
                            ++++ + l++gWk+ p+ s+S W+
  PGSC0003DMP400015916 369 DLQKDGKGLIIGWKGTPIHSLSIWK 393
                           999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.0581372IPR005202Transcription factor GRAS
PfamPF035142.5E-8923393IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MFIHPYGSAL SGLCMEETRD VELVHLLLAA AEEVNNQQFH LASKLISRCM WVASDSGNPV  60
QRLSFYFAKA LEERIDRSTG RYTCTDEDRH LKYIKTMSLG TNYAFLTCHK LIPFSQVMQF  120
AGVQTIVENV RSAKKIHLID FNIRSGIQWI VLIQALAEKG DSPIELLKIT AVGSTEKENF  180
EVTSNTLHSF AKSLGLSFSF DIVFVSDMKD FKKESVNIKT DETVAVYCNS VLRTMLLRPD  240
CLDNLMKVVR SIGPTIIVVG EVEANHNSPS FLNRFIETLY FYSAFFDCFE DCMDRGSPCR  300
TTIEGVYFGE GIRNIVAAEG EDRFTRNVKL EVWRAFFARF GMVEEELSES AWYQAHLILK  360
QFGQGSSCDL QKDGKGLIIG WKGTPIHSLS IWKLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-454139321375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400015916
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0AC238918.11 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349181.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1AI730.0M1AI73_SOLTU; Uncharacterized protein
TrEMBLM1AI740.0M1AI74_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000233450.0(Solanum tuberosum)
STRINGPGSC0003DMT4000233460.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.18e-54RGA-like 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]