PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400015915
Common NameLOC102597958
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 585aa    MW: 66026.8 Da    PI: 4.8552
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400015915genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS297.82.7e-912125821374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaalklf 84 
                           lv+lLl++Ae v++++++la++l++r    as +g+p+qRl +yf++AL++r+ rs+ +   + + ++    +     s  +  a+ + 
  PGSC0003DMP400015915 212 LVHLLLAAAEEVNNQQFHLASKLISRCMWVASDSGNPVQRLSFYFAKALEERIDRSTGRYTCTDEDRHL---KyiktmSLGTNYAFLTC 297
                           68*****************************************************33333222222222...11222223333333448 PP

                  GRAS  85 sevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeel 172
                           +++ P+ ++ +++  q+I+e v +++++H iDf+i  G+QW+ L+qaLa++  ++   l+iT+vgs   ++ke+ e t + L++fA++l
  PGSC0003DMP400015915 298 HKLIPFSQVMQFAGVQTIVENVRSAKKIHLIDFNIRSGIQWIVLIQALAEKGdSPIELLKITAVGS---TEKENFEVTSNTLHSFAKSL 383
                           99************************************************98344559********...5799**************** PP

                  GRAS 173 gvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleal 261
                           g++f+f+++ +++++d++ e+ ++k++E++aV +   l ++l ++ +l++    ++k+v+s+ P+++vv e ea+hns+sFl+rf+e+l
  PGSC0003DMP400015915 384 GLSFSFDIVFVSDMKDFKKESVNIKTDETVAVYCNSVLRTMLLRPDCLDN----LMKVVRSIGPTIIVVGEVEANHNSPSFLNRFIETL 468
                           *****************************************977777766....*********************************** PP

                  GRAS 262 eyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgy 349
                           ++ysa+fd++e  + r s  r+++E +++g+ i+n+va+eg++r+ r+ +le Wr+ + ++G+ + +lse+a  qa+l+l++++ +   
  PGSC0003DMP400015915 469 YFYSAFFDCFEDCMDRGSPCRTTIEGVYFGEGIRNIVAAEGEDRFTRNVKLEVWRAFFARFGMVEEELSESAWYQAHLILKQFGqGSSC 557
                           ************************************************************************************77779 PP

                  GRAS 350 rveeesgslvlgWkdrpLvsvSaWr 374
                            ++++ + l++gWk+ p+ s+S W+
  PGSC0003DMP400015915 558 DLQKDGKGLIIGWKGTPIHSLSIWK 582
                           999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.702186561IPR005202Transcription factor GRAS
PfamPF035149.2E-89212582IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MTNVSISNDI FSDFQDDQFH LKGYERSELV VNGIEEDCVD IDSLYSICGL NNEENTSDEQ  60
VRTNLLEDQQ QSLSDWTQNH FPTNTVMPLQ PVQIQSTIEA PKNDDFRPQV PEPGNSSNEK  120
PKPFSLASLE LLSNYGRLSK KSSEENLSTN ALSCEARLGN SQKLPMEEIL RAAGERYIQY  180
STQRLDGLSM FIHPYGSALS GLCMEETRDV ELVHLLLAAA EEVNNQQFHL ASKLISRCMW  240
VASDSGNPVQ RLSFYFAKAL EERIDRSTGR YTCTDEDRHL KYIKTMSLGT NYAFLTCHKL  300
IPFSQVMQFA GVQTIVENVR SAKKIHLIDF NIRSGIQWIV LIQALAEKGD SPIELLKITA  360
VGSTEKENFE VTSNTLHSFA KSLGLSFSFD IVFVSDMKDF KKESVNIKTD ETVAVYCNSV  420
LRTMLLRPDC LDNLMKVVRS IGPTIIVVGE VEANHNSPSF LNRFIETLYF YSAFFDCFED  480
CMDRGSPCRT TIEGVYFGEG IRNIVAAEGE DRFTRNVKLE VWRAFFARFG MVEEELSESA  540
WYQAHLILKQ FGQGSSCDLQ KDGKGLIIGW KGTPIHSLSI WKLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-4323058221375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400015915
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389180.0AC238918.11 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-210f9 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006349181.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1AI730.0M1AI73_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000233450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.13e-52RGA-like 2
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]