PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400015242
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 168aa    MW: 19754.8 Da    PI: 10.2553
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400015242genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.63.1e-4691353128
                   NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                           pGfrFhPt+eel+++yLk+ ++++k++  ++i  ++iy ++Pw+Lp +++ +e+ewyfF++ ++k+  + r+nr+t+sg+Wkatg+d++
  PGSC0003DMP400015242   9 PGFRFHPTEEELINFYLKRIINDDKIDS-NTIGFLNIYLYDPWELPGMARIGEREWYFFVPINRKHGPKGRPNRTTRSGFWKATGSDRQ 96 
                           9**************************9.88***************8888999************************************ PP

                   NAM  92 vlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                           + s+   ++++glkktLvfy grapkg++tdWvm+eyrl
  PGSC0003DMP400015242  97 IRSSlePKKAIGLKKTLVFYGGRAPKGTRTDWVMNEYRL 135
                           **99888889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100548.0447159IPR003441NAC domain
SuperFamilySSF1019411.57E-508141IPR003441NAC domain
PfamPF023659.4E-269135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MSLTELELPG FRFHPTEEEL INFYLKRIIN DDKIDSNTIG FLNIYLYDPW ELPGMARIGE  60
REWYFFVPIN RKHGPKGRPN RTTRSGFWKA TGSDRQIRSS LEPKKAIGLK KTLVFYGGRA  120
PKGTRTDWVM NEYRLPHGHK VLQFIMQTHN AKLYRYFVSS CIYLFIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-40413511140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400015242
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-126HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-126HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015160762.11e-103PREDICTED: NAC transcription factor 25-like isoform X1
SwissprotQ10S652e-68NAC22_ORYSJ; NAC domain-containing protein 22
TrEMBLM1AGL51e-121M1AGL5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000223651e-101(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.13e-67NAC domain containing protein 36
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Hong Y,Zhang H,Huang L,Li D,Song F
    Overexpression of a Stress-Responsive NAC Transcription Factor Gene ONAC022 Improves Drought and Salt Tolerance in Rice.
    Front Plant Sci, 2016. 7: p. 4
    [PMID:26834774]