PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400013897
Common NameLOC102584843
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family HB-other
Protein Properties Length: 341aa    MW: 39378.4 Da    PI: 5.8752
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400013897genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.16e-082783112154
                           HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           k +yp++e++++L k +gL+ +qV +WF N+R +
  PGSC0003DMP400013897 278 KWPYPTEEDKAKLVKDTGLQLKQVNNWFINQRKR 311
                           569*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.0E-1464108IPR005540KNOX1
PfamPF037902.4E-1566107IPR005540KNOX1
SMARTSM012566.5E-24117173IPR005541KNOX2
PfamPF037915.2E-18124172IPR005541KNOX2
PROSITE profilePS512139.394232252IPR005539ELK domain
PROSITE profilePS5007111.58252315IPR001356Homeobox domain
SuperFamilySSF466891.97E-15254317IPR009057Homeodomain-like
SMARTSM003891.9E-10254319IPR001356Homeobox domain
CDDcd000864.91E-10255315No hitNo description
Gene3DG3DSA:1.10.10.604.4E-25259315IPR009057Homeodomain-like
PfamPF059201.7E-17272311IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MEFHDHFSQE LALQQHQQQN VDDDVSDQSM NFNVKLSQQY RDDVNNNEHN NNNNNNSNVW  60
DQSEKYKADI LNHHLSEQLL SAHVACLRIA TPVDQLPRID EQLTESQNLV AKYYVVGQSQ  120
RSLDDKELDQ FMAHYVLLLS SFKEQLQQHV RVHAMEAVMA CWDLDQSLQN LTGVASGEGT  180
GATMSDDDED NQVENETYCH YNGILDGQDS NGFGPLVPTE NERFLMERVR QELKQEFKQD  240
YKGKIVDIRE EILRKRRAGK LPGDTTSALK AWWKSHSKWP YPTEEDKAKL VKDTGLQLKQ  300
VNNWFINQRK RNWHSTPSSS STQKSKRKSA GEKSRNDHFT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754511e-180HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006350068.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotP480001e-146KNAT3_ARATH; Homeobox protein knotted-1-like 3
SwissprotP480011e-146KNAT4_ARATH; Homeobox protein knotted-1-like 4
TrEMBLM1ADF40.0M1ADF4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000204070.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-138KNOTTED1-like homeobox gene 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]