PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400013790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 687aa    MW: 75439.3 Da    PI: 6.8295
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400013790genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.2e-28208261155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ eLH++Fv av+qL G ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  PGSC0003DMP400013790 208 KPRVVWAIELHKKFVTAVHQL-GLEKAVPKRILDLMNVEGLTRENVASHLQKYRL 261
                           79*******************.********************************7 PP

2Response_reg79.98.4e-27261341109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl vdD+p+ ++ll  +l+k +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+++++++ 
  PGSC0003DMP400013790  26 VLAVDDDPICLKLLDGLLRKCQY-HVTTTSQARTALKMLRENKdrFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANSDSKLVM 112
                           799********************.***************888889*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l+Kp+  eel +
  PGSC0003DMP400013790 113 KGITHGACDYLVKPVRLEELKN 134
                           *******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.7E-1571685IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23005.7E-4323159No hitNo description
SuperFamilySSF521721.71E-3523150IPR011006CheY-like superfamily
SMARTSM004488.4E-3224136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.27625140IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.5E-2426134IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.00E-2727140No hitNo description
PROSITE profilePS5129410.93205264IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-28205266IPR009057Homeodomain-like
SuperFamilySSF466895.55E-18205265IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-24208262IPR006447Myb domain, plants
PfamPF002493.6E-6211260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MTVEEIRGNM GGERENYDNF PVGMKVLAVD DDPICLKLLD GLLRKCQYHV TTTSQARTAL  60
KMLRENKDRF DLVISDVHMP DMDGFKLLEL VGLEMDLPVI MLSANSDSKL VMKGITHGAC  120
DYLVKPVRLE ELKNIWQHVI RRKKVEPKKQ NKSDDQDKAH QGGGEGERGS QLSGNADQNG  180
KVNKKRKDEE YESDENGNDD EDPGTQKKPR VVWAIELHKK FVTAVHQLGL EKAVPKRILD  240
LMNVEGLTRE NVASHLQKYR LFLKRINAAD AQQANLAAAA LGGKDSAYMR MGSLDGLGGF  300
RTLAGAGRFG QASLSSSYAS GGMLGRLNSP SGVSLRNLAS SPMLQPNHGQ NLSNNSINAL  360
MKFNANVPPA SQNANLFQGI PASLELDQLQ QSKCATHIRE LNPLDESGLH TMASTFSNSR  420
LVGSANSSMP NVSNNPILLQ VNSQQPLTGT GFGNQTSLNI ASFSSEAFNT GVSGSSNFLD  480
HDRYNENWQT SLQPLKFQST SFPLNEPFSN SHLPQDRVRD NDTSTGPLLQ NNPVDFSTSA  540
IVSVPFESSR GETQCRESLG GAVQIMNQAT CQRWPDQNQH YSHNSNNIFG NMSSQVSSNG  600
GMASLTHPMD QNNDMFCTRV ETSLTGRSNG GSSMHIHNRE SEKLTHDSRT KTNEDYLFQT  660
TKQQVGFLPQ GYGSLDDLMG EMKRVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-23206267364ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400013790
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754510.0HG975451.1 Solanum pennellii chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006350077.10.0PREDICTED: two-component response regulator ORR24-like
SwissprotQ6H8051e-138ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLM1AD540.0M1AD54_SOLTU; Two-component response regulator
STRINGPGSC0003DMT4000202330.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-125response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]