PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400012907
Common NameLOC102603543
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRAS
Protein Properties Length: 585aa    MW: 66248.2 Da    PI: 5.068
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400012907genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS299.39.7e-922145821374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalklfs 85 
                           lv+lLl++Ae v++++++la++ +a+    as +g+p+qRl +yf eAL++r+ r+ +      p+ e +          ++    + +
  PGSC0003DMP400012907 214 LVHLLLAAAEEVDQQQFHLASQSIAHCLWKASATGNPIQRLCFYFGEALQERIDREIK----RSPCFERKLGFlsnlALGNTPESLTCH 298
                           68*****************************************************322....223333321111111222222223356 PP

                  GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelg 173
                              P+ ++ +++ NqaI+e v+g++++H +Df+i  G+Q   L+qaL++R+  +   l+iT++g+   ++ke++eetg+rL++fA++l+
  PGSC0003DMP400012907 299 TEIPFSQVMQFAGNQAIVENVKGATKIHLVDFNIRSGIQCTGLMQALSERRdCPIELLKITAIGH---QEKEKIEETGKRLQSFAKSLN 384
                           667*********************************************999345569********...579****************** PP

                  GRAS 174 vpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                           +pf+f+++ +++++dl+ e+ +vk +E++aV +   l ++     + +++ d++++++++l+P vvvv+e ea+hns+sFl+rf+eal 
  PGSC0003DMP400012907 385 LPFSFDMVFMSDMKDLKAESVNVKADETVAVYCYTVLRTMI----CRQDYLDNTMRVIRGLRPSVVVVCEVEANHNSPSFLNRFVEALF 469
                           ***********************************999998....77778888************************************ PP

                  GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyr 350
                           +ys+lfd++e  + r++  r+ +E + +g+ i+n+va+egaer+ r+ +l  Wr+ + ++G+ +++lse+   qa+l+l++++ +    
  PGSC0003DMP400012907 470 FYSVLFDCFEDCMDRDNLVRKRIEVFHIGEGIRNMVAAEGAERFTRNVKLDVWRAYFVRFGMVEMELSESSRYQANLILKQFShGSSCI 558
                           ***********************************************************************************777788 PP

                  GRAS 351 veeesgslvlgWkdrpLvsvSaWr 374
                           v+++ ++l+ gWk+ p+ svS W+
  PGSC0003DMP400012907 559 VQNDGKALLVGWKGTPIESVSIWK 582
                           889999999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.579188561IPR005202Transcription factor GRAS
PfamPF035143.4E-89214582IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MDQIPIPTID FSVFQGGHNH VQECGRNELI NNGAVDPWFE LDSEDLDSLY TVFDLKYQDN  60
TSDKQVQSLE DQQQSISDHW TQSDDSSNMD LPLQPIQIQT TPKASNGIQP QEPRLDNFHG  120
EKTNSISLAS LELLNNCGRL FKKPSEENLS NALLSNEARV SNIPKLSTEE ILRVAGERYI  180
QYSTQRVDGL SMFIHPYASS LSGLSIEQTK DMELVHLLLA AAEEVDQQQF HLASQSIAHC  240
LWKASATGNP IQRLCFYFGE ALQERIDREI KRSPCFERKL GFLSNLALGN TPESLTCHTE  300
IPFSQVMQFA GNQAIVENVK GATKIHLVDF NIRSGIQCTG LMQALSERRD CPIELLKITA  360
IGHQEKEKIE ETGKRLQSFA KSLNLPFSFD MVFMSDMKDL KAESVNVKAD ETVAVYCYTV  420
LRTMICRQDY LDNTMRVIRG LRPSVVVVCE VEANHNSPSF LNRFVEALFF YSVLFDCFED  480
CMDRDNLVRK RIEVFHIGEG IRNMVAAEGA ERFTRNVKLD VWRAYFVRFG MVEMELSESS  540
RYQANLILKQ FSHGSSCIVQ NDGKALLVGW KGTPIESVSI WKFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-4523258221375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400012907
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006355859.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLM1AB560.0M1AB56_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000187920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-50RGA-like 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]