PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400012636
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 117aa    MW: 13588.4 Da    PI: 10.5419
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400012636genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1126.6e-35219553128
                   NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v s ++++vg+kktLv+y+grap+g +tdWvmheyrl
  PGSC0003DMP400012636  21 SKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKATGKDRKVNS-QTRAVGMKKTLVYYRGRAPHGARTDWVMHEYRL 95 
                           4667**************************************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.1611116IPR003441NAC domain
SuperFamilySSF1019413.53E-3620100IPR003441NAC domain
PfamPF023653.0E-182095IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MIKREGFRLS SNPKGKSLLP SKDLEWYFFS PRDRKYPNGS RTNRATKAGY WKATGKDRKV  60
NSQTRAVGMK KTLVYYRGRA PHGARTDWVM HEYRLDEREC EVANGLQDAY AKYLTY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-32189761144NO APICAL MERISTEM PROTEIN
1ut4_B2e-32189761144NO APICAL MERISTEM PROTEIN
1ut7_A2e-32189761144NO APICAL MERISTEM PROTEIN
1ut7_B2e-32189761144NO APICAL MERISTEM PROTEIN
3swm_A2e-32189764147NAC domain-containing protein 19
3swm_B2e-32189764147NAC domain-containing protein 19
3swm_C2e-32189764147NAC domain-containing protein 19
3swm_D2e-32189764147NAC domain-containing protein 19
3swp_A2e-32189764147NAC domain-containing protein 19
3swp_B2e-32189764147NAC domain-containing protein 19
3swp_C2e-32189764147NAC domain-containing protein 19
3swp_D2e-32189764147NAC domain-containing protein 19
4dul_A2e-32189761144NAC domain-containing protein 19
4dul_B2e-32189761144NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400012636
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2265091e-148AC226509.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0144P17, complete sequence.
GenBankHG9754411e-148HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-148HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006348211.12e-64PREDICTED: NAC domain-containing protein 86-like
RefseqXP_010316553.13e-64NAC domain-containing protein 86 isoform X1
RefseqXP_010316554.11e-64NAC domain-containing protein 71 isoform X2
RefseqXP_015065777.11e-64NAC domain-containing protein 71-like isoform X2
SwissprotA4VCM02e-52NAC45_ARATH; NAC domain-containing protein 45
TrEMBLM1AAH73e-81M1AAH7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000183645e-82(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA3070522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-58NAC domain containing protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]