PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400012529
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 205aa    MW: 24206.7 Da    PI: 9.7459
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400012529genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM898.5e-28161363128
                   NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                            GfrFhPtd el+ +yL + v +k+l++   i++ d+y+ +Pw +      +ek +yfF++ +kk+++++r  r++ sg Wk++ k k+
  PGSC0003DMP400012529  16 EGFRFHPTDRELM-KYLLHYVINKPLPTLVPIDQEDLYSKDPWVFF-D-GRKEKTMYFFTELKKKKKENTRYVRSVGSGSWKSQDKGKA 101
                           7************.99*********999888**************6.2.3467899********************************* PP

                   NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           v+s++g+  g k++L +   +a++ +  +W+m+ey++
  PGSC0003DMP400012529 102 VISERGSILGYKRSLRYQW-KASE-HDGQWLMKEYSI 136
                           ****************983.4444.589*******86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-2912164IPR003441NAC domain
PROSITE profilePS5100531.22714164IPR003441NAC domain
PfamPF023654.4E-1716136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAYDERKSSS YSVYTEGFRF HPTDRELMKY LLHYVINKPL PTLVPIDQED LYSKDPWVFF  60
DGRKEKTMYF FTELKKKKKE NTRYVRSVGS GSWKSQDKGK AVISERGSIL GYKRSLRYQW  120
KASEHDGQWL MKEYSISDEV KKQLRKRVRD YNKENYVLCR VKRKKGEDDP IEQKETIETE  180
ELNAIIDDPL NGVLKPIATL NLTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-1751676171Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144164RKRVRDYNKENYVLCRVKRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400012529
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754461e-135HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015082573.21e-114NAC domain-containing protein 1-like
TrEMBLM1AA791e-148M1AA79_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000182011e-149(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10241385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.19e-22NAC domain containing protein 32
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]