PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400010297
Common NameLOC102602614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 349aa    MW: 39938.3 Da    PI: 6.0449
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400010297genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1583.9e-49111391128
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPt+eel+++yL+kk++++k++l +vi+evd++k+ePwd+++k+k     +++wy Fs++dkky++g+r+nrat++g+Wkat
  PGSC0003DMP400010297  11 VPPGFRFHPTEEELLHYYLRKKIANEKIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYLFSHKDKKYPSGSRTNRATAAGFWKAT 98 
                           69****************************.9***************964444222455****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           g+dk ++  + + +g++ktLvfykgrap+g k dW+mheyrl
  PGSC0003DMP400010297  99 GRDKVIYG-NCKRIGMRKTLVFYKGRAPHGLKLDWIMHEYRL 139
                           *******9.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-558173IPR003441NAC domain
PROSITE profilePS5100554.38111173IPR003441NAC domain
PfamPF023654.5E-2612139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MNLSVNGQSQ VPPGFRFHPT EEELLHYYLR KKIANEKIDL DVIREVDLNK LEPWDIQEKC  60
KIGSTPQNDW YLFSHKDKKY PSGSRTNRAT AAGFWKATGR DKVIYGNCKR IGMRKTLVFY  120
KGRAPHGLKL DWIMHEYRLD DISTPQHEPP LNFCASESAA PEEGWVICRV FKKKSVLQSS  180
SAVISKTLTH ENTSTHHDGV LDQILMYMGR SSKQQHETKS SNIVQQVNNN DNGNIQFDNS  240
EDSFLHLPEL VNHHQDCNFD DEMIIMSTET DDQHYSCMIN NYQEDNEAAD HKKNGPTCDW  300
LALVASQLNG HHLEAPTNNN TTRSNDDDVE FWSYAQSSTF DPLSQFTV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-48817814170NO APICAL MERISTEM PROTEIN
1ut4_B5e-48817814170NO APICAL MERISTEM PROTEIN
1ut7_A5e-48817814170NO APICAL MERISTEM PROTEIN
1ut7_B5e-48817814170NO APICAL MERISTEM PROTEIN
4dul_A5e-48817814170NAC domain-containing protein 19
4dul_B5e-48817814170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400010297
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006352217.10.0PREDICTED: NAC domain-containing protein 66-like
SwissprotQ84WP62e-99NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM1A5170.0M1A517_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000148720.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-101NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  4. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  5. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  6. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  7. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  8. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]