PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400010076
Common NameBRC1A, STBRC1A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TCP
Protein Properties Length: 337aa    MW: 38095.4 Da    PI: 9.4407
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400010076genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP131.57.9e-411042513136
                   TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt................ssssasecea 75 
                            kkdrhski T+ g+RdRR+Rls+e+a++fF Lqd LGfdk+skt+eWLl+++k a+ +l++                  ss++++ce 
  PGSC0003DMP400010076 104 SKKDRHSKINTAHGPRDRRMRLSLEIARKFFNLQDLLGFDKASKTVEWLLTKSKSAVNDLVQKiskgkcsastnpnigvVSSPSESCEV 192
                           79*************************************************************88877766555555553333345533 PP

                   TCP  76 esssssasnsssgkaaksaakskksqksaasalnlakesrakarararertrekmriknkl 136
                            s +  +s+ +  ++  +++k+kks ++a  +  +akesr +arararert+ k++++n++
  PGSC0003DMP400010076 193 ISGVIDESAAT--NNTHKQQKKKKSIRRAIFHPVVAKESRTEARARARERTKIKKSLNNNN 251
                           33333333222..222222344444444445688999***************999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.4E-43104245IPR005333Transcription factor, TCP
PROSITE profilePS5136934.256105163IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.331227244IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MYPSSPNISS SSSFFHINIP SPSMQYEPEF IQYFHDFQFI QPAAYDQNNL DTNITAEEGD  60
HKMEEDELIM KSCKNKKDES TSTTTTIRRK NNKRTTSGTG VGPSKKDRHS KINTAHGPRD  120
RRMRLSLEIA RKFFNLQDLL GFDKASKTVE WLLTKSKSAV NDLVQKISKG KCSASTNPNI  180
GVVSSPSESC EVISGVIDES AATNNTHKQQ KKKKSIRRAI FHPVVAKESR TEARARARER  240
TKIKKSLNNN NGDQSMAPDE DLTRSLGSWS TTFEDHQSGI QAYNNTNNIM NAVDNFNLVD  300
TSNWSPFMFN YHQINTEISQ EHQLTNFQYP GKLWEA*
Function -- GeneRIF ? help Back to Top
  1. A Recently Evolved Alternative Splice Site in the BRANCHED1a Gene Controls Potato Plant Architecture.
    [PMID: 26119747]
  2. The BRC1a(Long) C-terminal region has a strong activation domain, whereas that of BRC1a(Short) lacks an activation domain and is predicted to form an amphipathic helix, the H domain, which prevents protein nuclear targeting.
    [PMID: 26119747]
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400010076
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM5972260.0HM597226.1 Solanum tuberosum BRANCHED1A isoform 1 (BRC1A) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341644.10.0PREDICTED: transcription factor BRC1a isoform X1
TrEMBLF6KB940.0F6KB94_SOLTU; BRANCHED1A isoform 1
STRINGPGSC0003DMT4000145720.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.13e-27TCP domain protein 12
Publications ? help Back to Top
  1. Mart
    Role of tomato BRANCHED1-like genes in the control of shoot branching.
    Plant J., 2011. 67(4): p. 701-14
    [PMID:21554455]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Nicolas M,Rodr
    A Recently Evolved Alternative Splice Site in the BRANCHED1a Gene Controls Potato Plant Architecture.
    Curr. Biol., 2015. 25(14): p. 1799-809
    [PMID:26119747]