PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400009699
Common NameLOC102598573
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 197aa    MW: 22833.3 Da    PI: 5.4858
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400009699genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM116.33.1e-3691281127
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                           lppGf F P+deel+v++L++k++  +++  +vi+++++++++PwdL+ k+ ++ ++wyf+s+r +      +++r+t++gyWk  g d
  PGSC0003DMP400009699   9 LPPGFWFCPSDEELIVHFLHRKISLLPCHP-DVIPDLHLHHYDPWDLDGKAMTGGNKWYFYSRRTH------ETSRITNNGYWKPLGVD 90 
                           79*************************999.99**************977778899******9977......578************** PP

                   NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                           +++ls+++++ g+kk  +fy g+ p+g+kt+W+m+ey+
  PGSC0003DMP400009699  91 ETILSTSNHNLGMKKYYTFYMGQPPQGHKTNWLMQEYS 128
                           *************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-457161IPR003441NAC domain
PROSITE profilePS5100542.3189162IPR003441NAC domain
PfamPF023659.7E-2010128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MGDNNNVKLP PGFWFCPSDE ELIVHFLHRK ISLLPCHPDV IPDLHLHHYD PWDLDGKAMT  60
GGNKWYFYSR RTHETSRITN NGYWKPLGVD ETILSTSNHN LGMKKYYTFY MGQPPQGHKT  120
NWLMQEYSHI SNSSPSPSSS RRRRSQSKTD YSKWVICRVY ESNCDSDEND DPELSCLDEV  180
FLSLDDLDDD EISLIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-36516816174NAC domain-containing protein 19
3swm_B4e-36516816174NAC domain-containing protein 19
3swm_C4e-36516816174NAC domain-containing protein 19
3swm_D4e-36516816174NAC domain-containing protein 19
3swp_A4e-36516816174NAC domain-containing protein 19
3swp_B4e-36516816174NAC domain-containing protein 19
3swp_C4e-36516816174NAC domain-containing protein 19
3swp_D4e-36516816174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400009699
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754491e-121HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBankHG9755221e-121HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341845.11e-145PREDICTED: NAC transcription factor 25-like
SwissprotQ8GWK64e-72NC104_ARATH; NAC domain-containing protein 104
TrEMBLM1A3N31e-144M1A3N3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000140301e-145(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37662447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.12e-64xylem NAC domain 1
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  3. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]