PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006720
Common NameLOC102581821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family SRS
Protein Properties Length: 384aa    MW: 41493.3 Da    PI: 8.2909
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006720genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022221.2e-681493093153
                DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.............aeaaskrkrel 78 
                            g+++CqdCGnqakkdC+h RCRtCCksrgf C+thvkstWvpaakrrer qql+++++++++++             +++ +kr+re+
  PGSC0003DMP400006720 149 GGGINCQDCGNQAKKDCSHLRCRTCCKSRGFPCHTHVKSTWVPAAKRRERLQQLTSLQQQQQQNQqqqtqllslradhHSNIPKRPRED 237
                           5789**************************************************99998888777789999999988777888888887 PP

                DUF702  79 kskkqsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                              ++s+l++t++++ +s  el  + +P+evss+avfrcv+vs+vdd+++++aY+tav+igGh+fkGiLydqG+e
  PGSC0003DMP400006720 238 --PSSSSLACTRIPNISSGLELGGH-FPSEVSSQAVFRCVKVSAVDDADDQYAYHTAVNIGGHLFKGILYDQGPE 309
                           ..78899*********999888876.***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051425.0E-66151309IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.3E-26153195IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016249.9E-27260308IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MSGFFTLGGG GAGGGNKNQQ QQQEQDQLAT NSLLLFKDDE IYNKGFELWQ QYYQLHQQRA  60
QPHPHHHHHQ PQDVDFSVGV GPSCNRRIIS TGSSSSSGGN NNIVGGGTDD HNHNHNHHQN  120
ITNNYTNSSS YRSSSGFRVM RPSSTGSAGG GINCQDCGNQ AKKDCSHLRC RTCCKSRGFP  180
CHTHVKSTWV PAAKRRERLQ QLTSLQQQQQ QNQQQQTQLL SLRADHHSNI PKRPREDPSS  240
SSLACTRIPN ISSGLELGGH FPSEVSSQAV FRCVKVSAVD DADDQYAYHT AVNIGGHLFK  300
GILYDQGPEG RYSGGGGGGE SSSGSGAAQQ ALNFITGATT STTAIAPTSH QHQPSVTMYD  360
PSVYPTPITA FLAGTQFFPP PRP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006341998.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like
TrEMBLM0ZWP40.0M0ZWP4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000096350.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.12e-61Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]