PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006341
Common NameLOC102580907
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 348aa    MW: 40036.7 Da    PI: 4.7719
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006341genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.22.3e-5581371129
                   NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                           +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL+ k    ++e++ewyfFs++dkky+tg+r+nrat +g+Wkat
  PGSC0003DMP400006341   8 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIRDIDLYRIEPWDLQdKcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKAT 95 
                           69****************************.9***************943432233667****************************** PP

                   NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                           g+dk+v++ k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  PGSC0003DMP400006341  96 GRDKAVYN-KSKLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 137
                           ********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-605157IPR003441NAC domain
PROSITE profilePS5100559.5858157IPR003441NAC domain
PfamPF023651.1E-289136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MDTNESCVPP GFRFHPTDEE LVGYYLRKKI ASQKIDLDVI RDIDLYRIEP WDLQDKCRIG  60
YEEQNEWYFF SHKDKKYPTG TRTNRATMAG FWKATGRDKA VYNKSKLIGM RKTLVFYKGR  120
APNGQKSDWI MHEYRLESEE NGPPQEEGWV VCRAFKKKIT GQTKTNNMVE GWESNYFYDE  180
ATTTVSSIVD PLEYITRQPP LLSNNFNMLQ NNLLCKQETS MEAAENNLNF SYTNSDQFIQ  240
LPQLESPSLP LLKRPISSMS LVSDYNNNNN HEEDGSKNVT ADWRALDKFV ASQLSHEETT  300
LYEDDQHNCS DLGMLLLLSD RGEGPKLNEI LSSSSEDCDI GVCLFDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-50816217170NO APICAL MERISTEM PROTEIN
1ut4_B1e-50816217170NO APICAL MERISTEM PROTEIN
1ut7_A1e-50816217170NO APICAL MERISTEM PROTEIN
1ut7_B1e-50816217170NO APICAL MERISTEM PROTEIN
4dul_A1e-50816217170NAC domain-containing protein 19
4dul_B1e-50816217170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400006341
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006340711.10.0PREDICTED: NAC domain-containing protein 37
SwissprotQ9SL411e-156NAC37_ARATH; NAC domain-containing protein 37
TrEMBLM0ZVN60.0M0ZVN6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000091360.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-146vascular related NAC-domain protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  3. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  4. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]