PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family TCP
Protein Properties Length: 158aa    MW: 18036.5 Da    PI: 10.2041
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006021genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP92.31e-2871137369
                   TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssss 69 
                           +++++ ski T++g+RdRR+Rls+  a++fFdLq+ LGfdk+skti+WL++ ++ a  elt+ s+ +
  PGSC0003DMP400006021  71 KRERSCSKILTAQGPRDRRIRLSIAMARKFFDLQELLGFDKPSKTIDWLFTHSQVALEELTNWSTHQ 137
                           577888*******************************************************985554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.10171130IPR017887Transcription factor TCP subgroup
PfamPF036341.3E-2777136IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MFSASNSSTH DNPLPQYISS SFHTSSPFVG LNGNQILLHQ YYQNQFSSHY LAKNNCVDSL  60
RSFPMKKKPK KRERSCSKIL TAQGPRDRRI RLSIAMARKF FDLQELLGFD KPSKTIDWLF  120
THSQVALEEL TNWSTHQTQI SGLILALTII KYQNEPS*
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers. Binds specifically to the DNA sequence 5'-GGNCCCNC-3', and is able to bind to the RAD promoter sequence in vivo. {ECO:0000269|PubMed:16236768, ECO:0000269|PubMed:8893002}.
UniProtInvolved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}.
UniProtInvolved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400006021
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-168HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069311.13e-83transcription factor CYCLOIDEA-like
SwissprotO492508e-30CYCLD_ANTMA; Transcription factor CYCLOIDEA
SwissprotQ9SBV65e-30CYCLD_ANTLN; Transcription factor CYCLOIDEA (Fragment)
SwissprotQ9SBV95e-30CYCLD_ANTMH; Transcription factor CYCLOIDEA (Fragment)
TrEMBLM0ZUX31e-113M0ZUX3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000086731e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43332244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.19e-24TCP domain protein 12
Publications ? help Back to Top
  1. Vieira CP,Vieira J,Charlesworth D
    Evolution of the cycloidea gene family in Antirrhinum and Misopates.
    Mol. Biol. Evol., 1999. 16(11): p. 1474-83
    [PMID:10555278]
  2. Gubitz T,Caldwell A,Hudson A
    Rapid molecular evolution of CYCLOIDEA-like genes in Antirrhinum and its relatives.
    Mol. Biol. Evol., 2003. 20(9): p. 1537-44
    [PMID:12832647]
  3. Reeves PA,Olmstead RG
    Evolution of the TCP gene family in Asteridae: cladistic and network approaches to understanding regulatory gene family diversification and its impact on morphological evolution.
    Mol. Biol. Evol., 2003. 20(12): p. 1997-2009
    [PMID:12885953]
  4. Costa MM,Fox S,Hanna AI,Baxter C,Coen E
    Evolution of regulatory interactions controlling floral asymmetry.
    Development, 2005. 132(22): p. 5093-101
    [PMID:16236768]
  5. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  6. Luo D,Carpenter R,Vincent C,Copsey L,Coen E
    Origin of floral asymmetry in Antirrhinum.
    Nature, 1996. 383(6603): p. 794-9
    [PMID:8893002]