PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400005813
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GRF
Protein Properties Length: 450aa    MW: 49387.9 Da    PI: 6.6769
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400005813genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.74.2e-23102144244
                   WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                            epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  PGSC0003DMP400005813 102 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHMHRGRPRSRKHVE 144
                           69***************************************98 PP

2QLQ50.65.7e-184377236
                   QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                          +FT+aQ+ +L++Q+++yKy+++   vPp+Ll+ i+
  PGSC0003DMP400005813 43 PFTWAQWKELERQAMIYKYMVSAISVPPDLLLSIC 77
                          9********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.3E-104278IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.6194378IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.4E-124377IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.213101145IPR014977WRC domain
PfamPF088794.0E-19103144IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MPFFSDEASL LPPAPSAAVV RSLQPFDVAT NSQGGMATAL GYPFTWAQWK ELERQAMIYK  60
YMVSAISVPP DLLLSICSGA SHTTSATGSV QGKRHTTNIR DLEPGRCKRT DGKKWRCSRD  120
VAPHQKYCER HMHRGRPRSR KHVEVHAGVS NASDNKKTRL QVESTTMAVT IPTTPASQIN  180
NRSTKQPLRS TFQQIQSPLF FHDDKIGGNG NISTDPSYNE LHRTSGWMME GELVAKADSG  240
QQWQHLMDSN AGYSAHGYRE EALNFLASRD MERTEHTGEF NFMTNPEFVK DVSKDSINGW  300
SNDNVYNNSN NENMEALLWP SLGNISPSSL TLSIAMAAGD VLDEDMGLDS RFMNTNQHKF  360
WENSFPFASG GPLAEVLHPS SSFSLGDNPT SSYTSNGDSI SPAATTVSSP SGVLQKTVFS  420
HSDGSVCNSP ILAAPSNITP ETVQFQWLR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400005813
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347500.10.0PREDICTED: growth-regulating factor 3
RefseqXP_006347501.10.0PREDICTED: growth-regulating factor 3
TrEMBLM0ZUG20.0M0ZUG2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000083520.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-35growth-regulating factor 7
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]