PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400005773
Common NameLOC102598455
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARR-B
Protein Properties Length: 682aa    MW: 75259.8 Da    PI: 6.5172
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400005773genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.3e-27211263255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           +r++W+ eLH++Fv av qL G+ekA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  PGSC0003DMP400005773 211 ARVVWSIELHRKFVAAVGQL-GIEKAVPKRILDLMNVDGLTRENVASHLQKYRL 263
                           79******************.********************************8 PP

2Response_reg80.94.1e-27281361109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl vdD+p+ ++ll  +l+k +y +v+++++++ al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+++ +++ 
  PGSC0003DMP400005773  28 VLAVDDDPICLKLLDGLLRKCQY-QVTTTSQARMALKMLRENRdrFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANSDTKLVR 114
                           799********************.***************999889*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + ++ Ga d+l+Kp+ +eel++
  PGSC0003DMP400005773 115 KGIDHGACDYLVKPVRIEELRN 136
                           ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.9E-1582672IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23003.3E-4325160No hitNo description
SuperFamilySSF521725.27E-3625152IPR011006CheY-like superfamily
SMARTSM004488.0E-3326138IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.89727142IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.6E-2428137IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.30E-2929142No hitNo description
PROSITE profilePS5129412.655207266IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-28207268IPR009057Homeodomain-like
SuperFamilySSF466891.97E-18207267IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-23211263IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 682 aa     Download sequence    Send to blast
MTVEEIRGNM GGGERGNNYD NFPIGMRVLA VDDDPICLKL LDGLLRKCQY QVTTTSQARM  60
ALKMLRENRD RFDLVISDVH MPDMDGFKLL ELVGLEMDLP VIMLSANSDT KLVRKGIDHG  120
ACDYLVKPVR IEELRNIWQH VIRKKKVEPK SQSKSNDQDK SYQVSGESGR GQSPTGNVDQ  180
NGKCNKKRKD EEDENDENGN DDEDPTTQKR ARVVWSIELH RKFVAAVGQL GIEKAVPKRI  240
LDLMNVDGLT RENVASHLQK YRLYLKRINS VQTQQANMVA ALGGRDYVRM GSLDGLGDFR  300
TLGGSGRYTH AALSSYSSGG MLGRLNSAAG LSVRNLAASQ LLQPSHGQNL SNSVNAFTKL  360
NPNIPPASQN ASLFQGIPAS LELDQLQQSK SSAHIPLDES RLLTAEVLGC SNNSLSNVPN  420
IPMLLQGNPQ QPLTGGGFGN QHSQNMTPFS SDSFNTGVNG SSNFLEHGRC NENWQNSIQL  480
SKFQSNSFPL TESFINSHLP QNSVREATTH LQNSPLDFTS TTSVSPPFED SRGEIQYRQS  540
MAGAVQSMNQ TPSQAWADNK QHYSHNSNNT FGNNLRSQVP NDGNMASLSH SMNQSNENFG  600
RRMDMSLIGR SSGGSSTLVQ QTEHEKLTLD SRTRSNEDYL LEPTKQQVGF SPQGYDSLDD  660
LMTAMKREQD GGMLDEGTIW I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-24206269164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400005773
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343681.10.0PREDICTED: two-component response regulator ORR24-like
SwissprotB8AEH11e-139ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLM0ZUD30.0M0ZUD3_SOLTU; Two-component response regulator
STRINGSolyc07g005140.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-119response regulator 12
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]